KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA21457
Entry
Dpse_GA21457      CDS       T01032                                 
Name
(RefSeq) uncharacterized protein
  KO
K07765  S2P endopeptidase [EC:3.4.24.85]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dpse_GA21457
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dpo01002]
    Dpse_GA21457
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.85  S2P endopeptidase
     Dpse_GA21457
Peptidases and inhibitors [BR:dpo01002]
 Metallo peptidases
  Family M50: S2P protease family
   Dpse_GA21457
SSDB
Motif
Pfam: Peptidase_M50 PDZ DUF4344
Other DBs
NCBI-GeneID: 4805411
NCBI-ProteinID: XP_001361816
FlyBase: FBgn0081444
UniProt: A0A6I8UW42
Position
3:complement(16990275..16992233)
AA seq 506 aa
MDPVVFFVVVTSLYGVLYFFDRFFKSCMHYPYDAFLKNTGLSVNFMSLHWHTNAFNRALL
RWGSAGNSCTRNFMVTSFNVGVLLTFSLLPIGIILLIITIFSGGEADSSAPYASAMPVQL
EILLPGVNLPLEEIGYYITTLVLCLVVHEMGHAMAAVLEDVPVTGFGIKFFFCLPMAYTE
LSNDHLNSLRWFKKLRVLCAGIWHNFLFAGICYLLISTIGITMSPFFVYNEHVIVTELTR
KSALRGERGLKVDNLITQVNGCPISSVESWHSCLYSSMKKRAGYCVSADFIQLNDESSAI
SHHSVDGQLQCCDELNPNVSCFEVVEDVNGDVPVELPQHVCLNVRRTLEEVTEHCTSGLC
SEGFCLRPLMRNITAIMTFKRLNLNSEKLPPVIYVGHPWDVSRTVEVSAFVPRYRFLSAA
WPDAWFLLLKYNVVFSIGLALVNAIPCFGFDGAHITSTVIHSFLVGKVDQYAKRDLISVI
ITSVGSLLFGLALLKVAWLSFLRPLM
NT seq 1521 nt   +upstreamnt  +downstreamnt
atggatcctgtggtgttcttcgtagtggtgacgtccctctacggcgtcctatattttttc
gatcgctttttcaaaagctgcatgcactacccatacgatgcctttctgaagaacaccgga
ctgtctgtgaactttatgagcctgcactggcacacgaacgctttcaatcgggcgctgctg
cgctggggatccgccggcaacagctgcacccgcaacttcatggtcactagcttcaatgtg
ggcgtgctgttgaccttctcactgctgcccatcggcatcatcctgctcattatcacgata
ttcagtggcggcgaggcagactcatcagccccgtatgcctcggcaatgccagtacagctg
gagattctgctgcctggcgtcaacctgccgctggaggagatcggctactacattacgact
cttgtgctttgcctggtggtccacgaaatgggtcacgccatggcggctgtgctggaggat
gtccctgtgactggtttcggaattaagttctttttctgcctgccgatggcctacacagag
ctctcgaacgaccacctgaacagcctgcgctggttcaagaagttgcgggtcttgtgcgcg
ggcatttggcacaactttctgtttgccggcatctgctacctgctcatctcgacgattggc
atcaccatgtcccccttcttcgtgtacaacgaacatgtgatagtcacggagctgacccgg
aagtcggcgctgcgaggagagcgcggactgaaagtggacaatctcatcacccaggtgaac
ggatgtccaataagcagcgtggaaagctggcactcctgtttgtacagttccatgaagaag
agggcaggctattgcgttagcgcagactttatccagctaaacgacgaaagcagcgccatt
tctcaccacagcgtcgatggacaattgcaatgctgcgacgagctgaatcccaacgtcagc
tgcttcgaggtggtggaggatgtgaacggcgatgtacctgtggagctgccccagcatgtt
tgcctcaacgtgcgtcgcacactggaggaagtcaccgagcactgcacatcgggcctttgc
tcggagggattctgtctgcgtccgttgatgcggaacataacagccataatgacgttcaag
cgtctgaatttaaatagtgaaaagctgccgccggtcatctatgtgggtcatccgtgggat
gtgtcacgcaccgttgaggtttcagccttcgtgccgcgctacaggttcctgagtgccgcc
tggccggacgcctggttcctgctgcttaagtacaacgtggtcttcagcattggcctggcc
ttagtcaacgccattccgtgctttggcttcgatggggctcacatcaccagcaccgtgata
cacagctttctggtgggaaaagtggaccagtatgccaagagggatctcatatcggtgata
atcactagcgtgggctccttgctttttggcctggccctgctcaaggtcgcctggctcagc
tttctcaggccccttatgtag

DBGET integrated database retrieval system