KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA21830
Entry
Dpse_GA21830      CDS       T01032                                 
Name
(RefSeq) uncharacterized protein, isoform A
  KO
K06497  CD63 antigen
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo04142  Lysosome
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    Dpse_GA21830
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dpo04147]
    Dpse_GA21830
   04090 CD molecules [BR:dpo04090]
    Dpse_GA21830
Exosome [BR:dpo04147]
 Exosomal proteins
  Proteins found in most exosomes
   Dpse_GA21830
CD molecules [BR:dpo04090]
 Proteins
  Dpse_GA21830
SSDB
Motif
Pfam: Tetraspanin GPHR_N DUF5804
Other DBs
NCBI-GeneID: 4816167
NCBI-ProteinID: XP_001355802
FlyBase: FBgn0081815
UniProt: A0A6I8VA41 Q29JV0
Position
4
AA seq 248 aa
MSILTGSANAVKYTLFGFNLIFLITGIILIAVGAGVGSVYTGYELFLAGKFFSIPTFLIV
IGAFIIVITFFGCWGALKENYCLVLSFSIMLAIIFILELSAGISGYVLRNDASSLIKTSL
TESLKDYNTFTQSPTTALWDDVQHDFNCCGVSDYKDWAVTYPNASLPISCCTIPVGAAGT
FSCFNNFTSEGVRHTYGCLDGFSNYIASHAVSLGAAGVVIAVLQFFGVIFACYIAREIKI
RNGITGFI
NT seq 747 nt   +upstreamnt  +downstreamnt
atgtcgattctaacgggcagcgcaaatgcggtcaagtacacgctttttggatttaacttg
atctttctgatcacgggcattatccttatagccgttggagccggcgtcggatctgtttac
actggctatgagctattcttggccggcaagttcttttcgatcccgacattcctcattgtg
atcggtgcctttatcattgtgatcacgttcttcggctgctggggtgcccttaaggagaac
tactgcctggtactaagcttctcgatcatgctggccatcatcttcatcctggagctgtcc
gccggcatcagtggctatgttctgcgcaatgatgccagctccttgataaagacatcgctg
acggaatcgctgaaggattacaataccttcacccagagcccaactactgccctgtgggac
gatgtccagcacgatttcaactgttgcggtgtgtccgactacaaagactgggctgtaacc
tacccgaacgcctccctgccgatctcgtgctgcacgattcccgtgggcgcagctggcacc
ttctcctgctttaacaactttacaagtgaaggtgtgcggcacacctacggttgtcttgac
gggttctccaattatattgcctcgcatgcggtcagcctgggtgcagctggcgttgtcatt
gccgtccttcagttcttcggtgtgatctttgcctgctatattgcacgtgagatcaaaatc
cggaacggcattacgggcttcatctag

DBGET integrated database retrieval system