KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA21879
Entry
Dpse_GA21879      CDS       T01032                                 
Name
(RefSeq) uncharacterized protein, isoform A
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    Dpse_GA21879
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dpo01002]
    Dpse_GA21879
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dpo04147]
    Dpse_GA21879
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     Dpse_GA21879
Peptidases and inhibitors [BR:dpo01002]
 Serine peptidases
  Family S1: chymotrypsin family
   Dpse_GA21879
Exosome [BR:dpo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dpse_GA21879
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF5518
Other DBs
NCBI-GeneID: 4816143
NCBI-ProteinID: XP_001355834
FlyBase: FBgn0081864
UniProt: Q29JR8
Position
4
AA seq 266 aa
MERFQPAICLMLLLLLVGCCLAGTARRPRLDGRIVGGQATTIEAIPYQVSLQRSYHFCGG
SLIGHGWVLTAAHCTEGSAIQVSKVRIGSTRTDSGGILVGIKRVHRHPKFDTYTIDYDFS
VLELEEYDKKNVTQAFIGLPKQDAGIADGTAVLVSGWGNTQSTQEPTSILRAVTVPTVSQ
TECTKAYGSFGTITDRMLCAGLQQGGKDACQGDSGGPLVANGTLWGVVSWGYGCARPDYP
GVYSRVSAVRDWIGSNSYFWRECPRR
NT seq 801 nt   +upstreamnt  +downstreamnt
atggaacgctttcagcccgccatttgcctgatgctcttgctccttctcgttggctgctgt
ctggcgggaacggcgcgtcggccacgcctcgatggacgcattgtgggcggccaggcgacg
actattgaggcgataccctaccaggtgtcgctccagcggagctatcacttttgcggcggc
tcgctgatcgggcacggatgggtcctcaccgctgcccactgcaccgagggatcggccatc
caggtgtccaaggtgcgcatcggctccacgcgcacagactctggcggcatcctggtgggg
atcaagcgcgtccatcgacatccaaagttcgacacctacaccatcgactacgacttttcc
gtgctggaattggaggagtacgacaagaagaacgtgacgcaggcatttatcgggctgccc
aagcaggatgcgggcattgcggatggcacagccgtcctggtctccggctggggtaatacc
caaagcacgcaggagccgacaagtatcctgcgggcagtgactgtgccgacagttagccag
acggagtgcaccaaggcctacggtagctttggaactatcacggatcgcatgctgtgcgcg
ggtctgcaacaaggaggcaaggatgcgtgtcagggagactccggtggtccgctggtcgcc
aatggaacgctgtggggcgtcgtttcctggggctacggctgtgcccggccagattaccca
ggcgtatactctcgagtgtcggccgttcgggattggataggatctaattcatatttttgg
cgggaatgtcctagaagatga

DBGET integrated database retrieval system