KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA23007Help
Entry
Dpse_GA23007      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo00020  Citrate cycle (TCA cycle)
dpo00640  Propanoate metabolism
dpo01100  Metabolic pathways
dpo01200  Carbon metabolism
Module
dpo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dpo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dpse_GA23007
   00640 Propanoate metabolism
    Dpse_GA23007
Enzymes [BR:dpo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     Dpse_GA23007
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Dpse_GA23007
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 6902103
NCBI-ProteinID: XP_002133634
FlyBase: FBgn0244409
UniProt: B5DL62
Position
XL
AA seq 342 aa AA seqDB search
MTMSNWRASGWLAPARLLRVVRGKSDYSKTAKNLKINKETKLLVQGFTGKQATFHSQEAL
KYGTNVVGGVSPKKGGTKHLDKPVFKSVAEATKELKPDATVIFIPPSNAADGIRSAIESE
IGLIVAITEGIPQVDMVRIMQMLNCQEKSRLLGPNCPGIISPDQCKIGIMPGDIHKRGCV
GIVSRSGTLTYEAVQQTTKTGLGQTLCIGCGGDPFNGTNFIDGLKIFLSDPETKGIILIG
EIGGSAEEDAAEFLKQHNSGCKAKPVVSFIAGQTAPPGRRMGHAGAIIAGGKGTAPAKVK
ALEKAGVIVSQNPCHMGSTLYKEMLRLKLVPKKEEAGSSNKK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgtccaattggcgagcaagcggctggttggcgcccgcgcggctgcttcgtgtg
gtgcgcggcaagtccgactacagcaagacggccaagaatctgaagatcaacaaggagacc
aagctgctggtgcagggattcaccggcaagcaggccaccttccactcgcaggaggccttg
aagtacggcaccaatgtggtcggtggtgtgtcgcccaagaagggcggcaccaagcacctg
gacaagccggtcttcaagagcgtcgcggaggcgacgaaagagttgaagccggacgccacc
gtgatcttcattccgccgagcaatgccgccgatggcatccgttcggccatcgagagcgag
atcggtctgatcgtggccatcacggagggcataccgcaggtggacatggttcgcatcatg
cagatgctgaactgccaggagaagtcccgcctcctgggccccaactgcccgggcatcatc
tcccccgatcagtgcaagattggcatcatgcccggcgatatccacaagcgcggctgcgtc
ggcatcgtctcccgttcgggcaccctcacctacgaggccgtccagcagaccacaaagacc
ggcctcggccagacgctgtgcatcggctgtggcggcgaccccttcaacggcaccaatttc
atcgatggactcaagatctttctgtctgaccccgagaccaagggcatcatcctcattggc
gagatcggcggcagtgccgaggaggacgccgccgagttcctcaagcagcacaactccggc
tgcaaggccaagcccgttgtcagcttcattgccggacagaccgccccgcccggccgtcgc
atgggccatgcgggtgccatcattgccggcggcaagggcacggccccggccaaggtgaaa
gcactggagaaggcaggcgtcatcgtgtcccaaaatccctgccacatgggctccaccctc
tacaaggagatgctgcgcctcaagctcgtccccaagaaagaggaggccggctccagcaac
aagaagtag

DBGET integrated database retrieval system