KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA23996Help
Entry
Dpse_GA23996      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dpo01009]
    Dpse_GA23996
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     Dpse_GA23996
Protein phosphatases and associated proteins [BR:dpo01009]
 HAD phosphatases
  Other HAD phosphatases
   Dpse_GA23996
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Motif
Other DBs
NCBI-GeneID: 6903777
NCBI-ProteinID: XP_002136699
FlyBase: FBgn0245395
UniProt: Q29LF2
Position
Unknown
AA seq 236 aa AA seqDB search
MSELVSSSRHCCFRPVTHCIFELDGLLLDSERLNTRAVQQILDPFGHIYGFDLKLRCMGK
PSPESADMIIDSYGLPLSRTQFQRLHRLHSRDHLGSVGLMPGAERLLRHLHASHVPLALE
TSGSRESYDLKVRPHAQLFEVFQHAVVGGSDPEVKRCKPSPDIFLTAAARFKEPPEPENC
LVLESSLLGMEAALAAGMQVVLVPDPLLSIRLSAPATLRLRSLEAFRPQYFGLPPF
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaattggtttcctcgtcgcggcactgctgcttccgacccgtgacccactgcatc
ttcgagctggacggcctcctgctcgacagcgagcgcctgaacacgcgggcggtgcagcag
atcctcgaccccttcggccacatctacggcttcgacctgaagctgcggtgcatgggcaag
ccctccccggagtcggcggacatgatcatcgacagctacggcctgcccctcagccgcacg
cagttccagcgcctccacaggctccacagtcgggaccacttggggtccgtgggcctgatg
cccggcgcggagcgcctcctgcgccacctgcacgcctcccacgtgcccctggccctcgag
acgagcggcagtcgagagtcgtacgacctcaaggtgcgtccccacgcccagctcttcgag
gtcttccagcacgcggtcgtcggcggctccgacccggaggtgaagcggtgcaagccctct
ccggatatattcctcacagccgccgctcgcttcaaggagcccccggagccggagaactgc
ctggtgctggagtcctcgctactgggcatggaggctgccttggccgccggcatgcaggtt
gtgctcgtgccggatcccctgctctccattcgactcagtgctccggccacactgaggctc
cgctcgctggaggccttcaggccgcagtactttggactgccccccttctga

DBGET integrated database retrieval system