KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA24414Help
Entry
Dpse_GA24414      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dpo01002]
    Dpse_GA24414
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:dpo03110]
    Dpse_GA24414
Enzymes [BR:dpo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     Dpse_GA24414
Peptidases and inhibitors [BR:dpo01002]
 Serine peptidases
  Family S8: subtilisin family
   Dpse_GA24414
Chaperones and folding catalysts [BR:dpo03110]
 Intramolecular chaperones
  Subtilisin family
   Dpse_GA24414
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 TPPII TPPII_N DUF5539
Motif
Other DBs
NCBI-GeneID: 4804053
NCBI-ProteinID: XP_001360674
FlyBase: FBgn0245811
Position
3
AA seq 1431 aa AA seqDB search
MLNKFRVVHNKLRLYKNFELLGQKAAIEFTLPSVSFCTPHLAYIGTERSMVMIASAATTR
QFREHGENSNKFENMSMATSGIVESFPTGALVPKAETGVLNFLQKYPEYDGKDVTIAIFD
SGVDPRATGLETLVDGKTIKVIERYDCSGCGDVDMKKKVTPDENGTLKGLSGTTLTLSPE
LLALNTDNDKAVRVGLKCFGDLVPSKVRDNIVAQAKLKHWDKPHKIATANASRKISEFES
QNTGEAPKMPWDKKIIKENLDFELEMLNSYEKVYNDVKTSYDCVLFPTANGWLTLIDTTE
QGNLDQALRIGEYSKTHETQNVDDFLSISVNVHDEGDVLEIVGMCSPHGTHVSSIASGNH
SSRDVDGVAPNAKIVSMTIGDGRLGSMETGTALVRAMTKVMELCREGRRIDVINMSYGEH
ANWSNSGRVGDLMNEIVNKYGVVWVASAGNHGPALSTVGTPPDISQPSLIGVGAYVSPQM
MEAEYAMRDKLPGNVYTWTSRDPCIDGGQGVTVCAPGGAIASVPQFTMSKSQLMNGTSMA
APHVAGAVALLISGLKQQNIEYSPYSIKRALSVTATKLSYVDPFAQGHGLLNVEKAFEHL
VENRQSKDNMLRFSVRVGNNQAKGIHVRQGVLRNFIDFNVNIEPVFFNDKETDPKDKFNF
NVRLNLISSQTWAQCGSFLDLSYGTRSIVVRIDPTGLPPGVHSAVIRAYDTDCVTKGPLF
EIPVTVVQPHVLESDLNTPIFEPASSKGDNSVEFQPNTIQRDFILVPDRATWAVLRMRIT
DPNRGKDTGKFFLHTNQLLPKQSCRKNETMKIISVSSDHETTTTFRVKAGKILELCIAKY
WSNYGQSHLKYSLEFRGVEASNPNAYVMHAGKGIHKLEIEALVAEDILPQLQLKTAAVVL
KPTEAKISPLSATRDVIPEGRQVYQNLFVYNLNVAKAAEVSLHAPIFNDSLYESEFESQM
WMLYDGNKALVATGDAHSQNFFTKLEKGEYTIRLQVRHEKRDLLEKISDANLVASFKLVN
ILNLDFYENYNHCIVGGRKLAAAVVRRSTRVVYIAPISQERLNKANLPAQCAWLSGNLVF
PKDEAGRRVALHSFTYILNPAEKKTNSSGNGNSSANASVAAAAPAAVSANTTKPKAPATP
PAATSVNPANSAAGDGVATQTDTSSEGNGSPASPKKGKTNSDEYSEILRDFQCTHIVKCE
PEMAEKIYNEVVEAHPKHLQAHLLLIQNIEAAQLKSAFPLTFTNGQKSENPVGENADQQK
EEQKKLRSALERVIKLAENVIVETDAEALLSYYGLKNDTRPDAAKIKTNMDKQRNNLIEA
LSKKGIAIAKLAVLDDSLKDRLADINDVYTHIIKFVDANDSKAIQFALWHAYAHAHYGRM
YKYIVKLIEDKRTREQYDELAAINSALGHEHITAVIKRMTVSSFPSTYRLF
NT seq 4296 nt NT seq  +upstreamnt  +downstreamnt
atgttaaataaattccgtgttgtgcacaataaactgcgattatataagaattttgaattg
ctcggacagaaggcagcgatcgaattcacattgcccagcgtcagcttctgcacgccgcac
ttggcgtatataggcacggaaaggagcatggtgatgatagcttcggcagcaacaacgcga
cagtttcgagaacacggtgagaacagcaataaattcgaaaatatgagtatggctacaagc
ggaattgtcgagtcatttcctacgggtgccctggtgcccaaggcggagacaggagtgcta
aattttctgcaaaagtatcccgaatacgacggcaaagatgtaaccattgccatatttgat
tccggtgtagatcctcgggctaccggacttgagacgcttgtcgatggcaaaacgattaaa
gtgattgagcgctacgactgctcgggatgcggcgacgtagatatgaagaaaaaggtaaca
ccagatgaaaatggaaccctgaagggtttgtctggcaccaccttgacactcagtccagag
ctgctggctctgaacacggacaatgacaaggcggttcgcgtgggcctcaagtgcttcggt
gatctggtgccctccaaggtgcgcgacaacattgtagcccaggccaagctgaagcactgg
gataagccccacaagatagccacggccaacgccagtcgcaagatatctgaattcgagtca
caaaatacaggtgaagcccccaaaatgccgtgggacaagaaaatcatcaaagagaaccta
gactttgagctggagatgctcaatagctatgagaaggtctacaacgacgttaaaacctcg
tacgactgtgtcctctttcccacggccaacggatggctaaccctcatcgacaccaccgag
cagggcaacctggatcaggccctgcgcattggcgagtactcaaagacgcacgagacgcag
aacgtagatgacttcctgtcgatatcagtaaacgtccacgatgagggcgatgttctggaa
atcgtcggcatgtgctcgccccatggcacgcacgtctcgtcgatagccagtggcaaccac
agctccagagacgttgacggcgtagcaccgaatgccaaaatcgtgtccatgaccatcgga
gatggccgcctggggtccatggagactggcaccgctctggttcgggccatgacgaaggta
atggagctgtgccgcgagggaagacgcatcgacgtgatcaacatgagctatggcgagcat
gccaactggtcgaattccggccgcgttggcgacctaatgaacgagatcgtaaacaagtat
ggcgttgtctgggtagcttccgcgggcaaccatggaccagcgctcagcactgttggcaca
ccgccggatatcagtcagcccagcctgattggcgtgggtgcctatgtctcgccccaaatg
atggaggcagagtatgccatgcgggacaagctgcccggcaatgtgtacacatggacctcg
cgcgatccctgcatcgatggcggccagggcgttacggtctgtgctcccgggggggccatt
gcgtccgtaccacagttcaccatgagcaagtcgcagctgatgaatggcaccagcatggcc
gcaccccatgtggccggtgctgtggccctgcttatctccggactcaaacagcaaaacatt
gagtattcgccgtacagtattaagcgtgccctgagcgtcactgccaccaaactgagctat
gtggatccctttgcccagggtcacggactgctgaatgtggagaaggccttcgagcatttg
gtggagaatcgtcagtccaaggataatatgttgcggttctcggttcgcgtgggcaacaac
caggccaagggcatccacgttcggcaaggcgtcctccgtaatttcatcgatttcaatgtc
aacatcgagccggtcttcttcaacgacaaggagacggatcccaaggataagtttaacttt
aatgtgcgtttgaatctgataagctcccagacctgggcgcagtgtggctcctttctggat
ctcagctatggcactcgctccattgtcgtccgcatcgaccccacaggacttcctcccggc
gtacacagcgctgtgattcgagcctacgacacggactgcgtcaccaagggccctctcttt
gagatccctgtgactgtggtgcagccccatgtcctagagtctgatctgaacacaccaatc
ttcgagccagcctcctccaagggggacaacagcgttgagttccagcccaataccattcag
cgggactttatcttggtcccagaccgtgccacctgggcagtgctgcgcatgcgcatcacc
gatcccaatcgtggcaaggacacaggaaaattcttcctacacaccaatcagttgctgcca
aagcagtcctgccgaaagaacgagaccatgaagatcatttccgtcagctcggaccatgaa
acgaccacgacctttagggtaaaggctggcaagattctggagctgtgcatagccaagtat
tggtccaactatggccagagtcacttgaagtacagcctggaattccgtggcgtcgaagcc
tccaatcccaatgcatatgttatgcacgctggcaaaggtattcacaaactggaaatcgag
gccctggtggcggaggatatcctgccacagctgcaactgaagactgccgccgttgtgctg
aagcccactgaggcaaagatctcgccattgagcgccacccgtgatgtcataccagagggt
cgacaggtataccagaacctatttgtgtacaatctgaatgtggccaaggcggcggaggtg
tccctccatgctcctattttcaatgattcgctgtacgagtcggagttcgaatcccagatg
tggatgctgtacgatggaaataaggccttggtggccaccggcgatgcacactcgcagaat
ttcttcacaaagctagagaagggcgaatatacaattcgcctgcaggtgcgtcacgagaaa
cgcgatctgctggaaaagatttcggacgccaatctggtggcctcgttcaagcttgtcaat
atcctcaacctcgacttctacgagaactacaatcattgcattgtaggagggcgcaagctg
gctgccgctgtggtgcggcgatccacgcgagtggtgtacattgcccccattagccaggag
cgtctgaacaaggccaatctcccggctcagtgtgcctggctgtccggcaacctggtcttc
cccaaggacgaggcaggccgtcgtgtggcgctacattcattcacttatatcctcaatcct
gccgagaagaagacaaattcatctggaaacggcaacagctctgcaaatgcctcggtagca
gcagcagcacccgctgccgtcagcgccaatacaaccaagccaaaggctccggccacgccg
ccggcagccacgtccgtcaatccggccaattcagccgccggcgatggagtcgccacgcag
accgacacgtcatcggagggcaatggcagtcccgcctcgcccaagaaggggaaaacaaat
tcggatgaatatagcgagattttgcgtgacttccagtgcacgcacattgtcaagtgtgaa
ccggagatggccgagaagatatacaacgaggtggtggaagcccatcccaagcatttacag
gcacatctgctgctcatccagaacatcgaggcagctcagttgaagtctgcttttccgctg
acctttacaaatggtcaaaagagcgagaatcctgtgggagagaatgccgaccagcagaag
gaagaacagaagaagctgcgaagtgccctggaacgcgtgatcaagctggccgagaatgtg
attgtggaaaccgatgcagaggcattgctatcctactacgggctcaagaacgacactcgt
cccgatgcggccaagattaagaccaacatggacaagcagcgaaacaatctcatcgaagcc
ctcagcaagaagggcatagccattgccaagttggctgtcctggatgacagtctcaaggat
cgcctggccgatataaacgatgtgtacacgcatattatcaagtttgtggacgccaacgac
tcgaaggcaatacagtttgcattgtggcatgcctacgcccatgcccactacggacgcatg
tacaagtacattgtgaagctgattgaagacaagcgcacacgcgagcaatacgacgaactg
gccgccatcaacagtgccttggggcacgagcacattacagcagttattaaacgcatgact
gtctcctctttcccaagcacataccgtctgttctaa

DBGET integrated database retrieval system