KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA26189Help
Entry
Dpse_GA26189      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo03040  Spliceosome
dpo04141  Protein processing in endoplasmic reticulum
dpo04144  Endocytosis
dpo04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    Dpse_GA26189
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dpse_GA26189
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    Dpse_GA26189
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    Dpse_GA26189
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dpo01009]
    Dpse_GA26189
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dpo03041]
    Dpse_GA26189
   03009 Ribosome biogenesis [BR:dpo03009]
    Dpse_GA26189
   03110 Chaperones and folding catalysts [BR:dpo03110]
    Dpse_GA26189
   04131 Membrane trafficking [BR:dpo04131]
    Dpse_GA26189
   03051 Proteasome [BR:dpo03051]
    Dpse_GA26189
   03029 Mitochondrial biogenesis [BR:dpo03029]
    Dpse_GA26189
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dpo04147]
    Dpse_GA26189
Protein phosphatases and associated proteins [BR:dpo01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     Dpse_GA26189
Spliceosome [BR:dpo03041]
 Complex B
  Other components
   Prp19 complex
    Dpse_GA26189
 Complex C
   Prp19-CDC5 complex
    Dpse_GA26189
Ribosome biogenesis [BR:dpo03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    Dpse_GA26189
Chaperones and folding catalysts [BR:dpo03110]
 Heat shock proteins
  HSP70 / DNAK
   Dpse_GA26189
Membrane trafficking [BR:dpo04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    Dpse_GA26189
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    Dpse_GA26189
Proteasome [BR:dpo03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    Dpse_GA26189
Mitochondrial biogenesis [BR:dpo03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    Dpse_GA26189
Exosome [BR:dpo04147]
 Exosomal proteins
  Proteins found in most exosomes
   Dpse_GA26189
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl BcrAD_BadFG FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 6897906
NCBI-ProteinID: XP_002138008
FlyBase: FBgn0247564
Position
2
AA seq 656 aa AA seqDB search
MSEAPAIGIDLGTTHCCVGVFQNGKVEIIANDQGNRTTSSYVAFTDTERLIGDAAKNQVT
VNPNQRIFESKRLIGRKFKDSAVQADMKYWPFDVVSVDGKPKIEVTYKDEKKTFFAEEIS
AMVLTKMKETAEEYLGKTVTKAVISVPAHFNDSQRQATKDAGTIAGLKVLRIINEPTAAA
IAYGLDKKAVGERNVLIFDLGGGTFDVSILSINDGIFKVKSTAGDTHLGGEDFDNRLVTH
FVQEFNRNHKKDLTSNKRALRRLRTACERAKRTLSSSTLARIEIDSLFEGTDFYTSITRA
SFEELNADLFRSTMDPVEKALRDAKLDKSAIHDIVLVGGSTRIPKVQRLLQDLFNGKELN
KSIDPDEAVAYGAAVQAAILHGDKSKELQKVLLVDVIPLSLGIETAGGVMNVLIKRNTSI
PAQAEFFTSYLNNPAGVPIQVYEVECGMTKQNNLLGKFQVLGTPPANRRGRGMPSIQVTF
NIDLNGILYVTANCTINMEKTITVTKEKGRLSQEDIKRMVNEAENYRKEDKKQNETISAK
HGLESYCFNMKATIDEYSLRTKIADSDLTVILDRCNGAIKWLDAKQLARKEEYEHHQKLL
ESLCNPIITKLWQSAGPVPGGMRYAGGMPGALGAAGDGAPCAGAGIGRGPTIEQGN
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagcacctgctattggtattgatttgggcacaactcactgctgtgtgggtgtg
ttccagaatggcaaggtcgagatcattgccaacgaccagggtaatcgtaccacatcatcc
tatgttgccttcacggatacggagcgcttgattggtgatgccgccaagaaccaggtgacg
gtgaacccaaaccagaggatcttcgaatcgaagcgtctgattggtcgcaagtttaaggat
tctgctgtccaggctgacatgaagtactggcccttcgatgtggtcagtgtagacggcaag
cccaagattgaggttacgtacaaggacgagaagaagaccttcttcgccgaggagatctct
gccatggtgttgaccaaaatgaaggagaccgccgaggagtacctgggcaagacggtgacc
aaagctgtcatctctgtgccagcccacttcaacgactcgcagcgtcaggctaccaaggat
gccggtaccatcgccggtttgaaagtcctgcgtatcatcaacgagcccacggccgctgca
atcgcctatggcctggacaagaaggctgttggtgagcgcaacgtgcttattttcgatctg
ggtggcggtaccttcgatgtgtccattctttcgatcaatgatggcatcttcaaggtcaaa
tctacggccggtgatacccatcttggtggtgaggatttcgacaaccgtctagtgacccac
tttgtgcaggagttcaatcgcaatcacaagaaggacctgaccagcaacaagcgtgctctg
cgtcgtctgcgcaccgcctgcgagcgcgcaaagcgcaccctctcatcgtccactctggcc
agaattgagattgactctctgttcgagggtaccgatttctacacctcgatcactcgtgcc
agtttcgaggagctgaacgccgatctgttccgcagcaccatggatcccgtggagaaggct
ctgcgtgacgccaagctggacaagtcggccatccacgacattgtgttggtcggtggctcc
acccgtatccccaaggtgcagcgcttgctccaggatctgttcaacggcaaggagctgaac
aagtcgattgatcccgatgaggctgttgcctatggcgccgccgtccaggccgccatcttg
catggcgataagtcgaaggagctgcagaaggtcctgttggtcgatgttatccctctgtct
ctgggtatcgagactgccggcggtgtgatgaacgtgctgatcaagcgcaacaccagcatc
cctgcacaggcggagtttttcaccagctacttgaacaacccggctggtgtaccaatccaa
gtttatgaagtcgagtgcggcatgaccaagcagaacaatctcctgggcaagttccaggta
ttgggcacccctccagcaaatcggcggggacgcggcatgccctcgatccaggtcacattc
aacattgatctcaacggcatcctgtacgtcactgccaactgtaccatcaacatggagaag
acgatcaccgtcaccaaggaaaagggtcgtctctcccaggaggatatcaagcgcatggtc
aacgaggccgagaattaccgcaaagaggacaagaagcagaacgagactatctccgccaag
cacggcctcgagtcgtactgcttcaacatgaaggccaccatcgacgagtacagtctaagg
accaagatcgccgattctgacctcaccgtcatcctggacaggtgcaacggggccatcaag
tggctggatgccaaacagctggcccgtaaggaggaatacgagcaccatcagaaattgctc
gagagtctctgcaacccgatcatcaccaagctgtggcagagcgctggccctgttcctggt
ggcatgcggtatgccggcggtatgcccggtgctctcggtgcagctggagatggtgctccc
tgtgccggtgccgggatcggccgtggccccaccatagagcagggcaactaa

DBGET integrated database retrieval system