KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA26234Help
Entry
Dpse_GA26234      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K20031  palmitoyltransferase ZDHHC6 [EC:2.3.1.225]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dpo04131]
    Dpse_GA26234
Enzymes [BR:dpo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     Dpse_GA26234
Membrane trafficking [BR:dpo04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    Dpse_GA26234
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC SH3_2
Motif
Other DBs
NCBI-GeneID: 6897834
NCBI-ProteinID: XP_002137939
FlyBase: FBgn0247608
UniProt: B5DW29
Position
2
AA seq 426 aa AA seqDB search
MFCDWLNELQRFLHWGPVIVFSLMTCVTWTTVHVNAMWWPPAESFNAAINFVLIVFFNLI
TLYHFSMSILVGPGLLPKHWRPENPEDEQFLQFCKVCDGYKAPRAHHCRRCKRCVLRMDH
HCPWINNCIGWANQANFFYFLFFFMLGSIQSALIIGFSCYEGIYRRALLKQGDTNGIRVV
LTLRSAMACMYSLGIVVGVLLATLKLMQLQIKAIIWNLSEIEGWIVKKAEYRRYASSSIG
IAIPTFDYPYDMGVWRNILETFTPSNDGINWPVRPGCDQYTMTREQLAQKVQKRARTRTY
RCIASATGYWLPILSQGLMVTICMPCADDPRIVVHKGDLVQVTRVQEYWLYGERVLSKRE
QKLQKKLQLKGHIRGWFPRCCAVEQFDEDQSAGDTVDVTHNTDQEKTKTGSKIKKRKPKP
NTFSLN
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgttctgcgattggttgaacgaattgcagcgtttcctgcactggggacccgtgattgtc
tttagtttgatgacctgcgtgacctggacaaccgtacacgtgaatgccatgtggtggccg
cccgcggagtcgtttaacgctgccatcaactttgttctgattgtgttcttcaatctgatt
accctttatcactttagcatgtcgattctggtgggacccgggcttctgccgaagcattgg
cggcccgaaaaccccgaggacgagcagttcctgcagttctgcaaggtgtgcgacggctac
aaggcaccgcgggcgcaccactgccgccgctgcaaacgatgtgtcttgcggatggaccac
cactgcccgtggatcaacaactgcatcggatgggccaaccaggcaaacttcttctacttc
ctattcttcttcatgctcgggagcattcagtcagccctgatcattggcttctcctgctac
gaaggcatctatcgcagggccctgctgaagcagggcgataccaacggaatccgagtcgtg
ttgaccctccgcagtgccatggcatgcatgtacagcctgggcattgtggtgggcgtgttg
ctggccacgctgaagctcatgcaactgcagatcaaggctataatttggaacctctccgag
atcgagggctggatcgtgaagaaggccgaataccgtcgctacgcgagtagttcgattgga
attgccattcccacattcgactacccgtacgacatgggcgtttggcgcaacatcctggag
accttcacacccagcaacgacggcatcaactggcccgttcgccccggctgcgatcagtac
actatgacgcgcgagcaactggcccagaaggtgcaaaagcgggcccgcacccgcacctac
aggtgcatagcatcggccacagggtactggctgcccatcctctcccagggcctgatggtc
accatttgtatgccctgcgctgacgatccacgcattgtcgtgcacaagggcgatctcgtg
caggtgacccgcgtccaggaatattggctctacggcgaacgcgtgctctccaagcgggag
cagaagctccagaagaagctccagctcaaggggcacatacgcggctggtttccgcgctgc
tgtgccgtcgagcagttcgatgaggaccagtctgccggtgacactgtggatgtcactcat
aacaccgatcaggagaagaccaagaccggatccaagataaagaagcgcaaacctaagccc
aacactttttcccttaattaa

DBGET integrated database retrieval system