KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA26338Help
Entry
Dpse_GA26338      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K14286  ethanolamine-phosphate phospho-lyase [EC:4.2.3.2]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo00564  Glycerophospholipid metabolism
dpo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dpse_GA26338
Enzymes [BR:dpo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.2  ethanolamine-phosphate phospho-lyase
     Dpse_GA26338
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 LupA
Motif
Other DBs
NCBI-GeneID: 6901500
NCBI-ProteinID: XP_002134186
FlyBase: FBgn0247712
UniProt: B5DN06
Position
XL
AA seq 497 aa AA seqDB search
MPFAQEQSKSSTVASEQLSKTETIKLRNKHIGQACQLFYRSDPLKIVRGQGQYMFDEEGT
RYLDCINNVAHVGHCHPEVVRAGALQMATISTNNRFLHDELVQCAQTLTSKMPEPLSVCF
FVNSGSEANDLALRLARNFTKRQDVITLDHAYHGHLQAVMEVSPYKFNQPGGEKKPDYVH
VAPCPDTYGGQFTDKMYPNADLGALYAQPIEEICQRQLAKGQGVAAFIAESLQSCGGQIL
PPPGYFRAAYDAVRSSGGLCIADEVQVGFGRVGTHYWAFETQGVVPDIVCVAKPMGNGHP
VGAVVTTPEIAQAFHATGVAYFNTYGGNPVSCAIANAVMRVIDQEGLQQNALQLGDYLLR
ECSHLKQEFECIGDVRGVGLFVGIELVKDREGRIPDTKSARWVVNRMKQLHQVLVSSDGP
NDNVIKLKPPMCFSRENADEFLLAFRECLATLTQDKLATEAATAAATTTHGVIATAAETL
ANKTKLFERQDRLIKSV
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgcctttcgcacaagagcaatcaaagtcgtcgacggtggccagcgaacagctgtccaag
acggaaaccatcaagctgagaaacaaacacatcgggcaagcctgccagctcttctatcgc
tctgatcctttgaagattgtccgcggacagggccagtacatgttcgatgaggaaggcaca
cgctatctggactgcattaacaatgtggcacatgtgggtcactgccatccggaggtagtg
cgtgccggtgccctacagatggccaccatctcgacaaacaatcgcttcctgcacgatgag
ctggtgcagtgcgcccagacgctgaccagcaagatgccagagccactgtccgtgtgcttt
ttcgtcaactcgggatcggaggccaatgacttggccctccgactggcccgaaactttacc
aagcgccaggatgtgatcacgcttgaccatgcctaccatggacatctgcaggcggtgatg
gaggtgtcgccgtacaagttcaatcagccggggggcgagaagaagcccgactacgtgcac
gtggccccctgcccggacacctatggcggccagttcacggacaagatgtaccccaacgcg
gatctgggggctctctatgcccagcccatcgaggagatctgccagcgccagttggccaag
ggccagggcgtggccgccttcatagccgagagcctgcagagctgcggcggacagattctg
ccaccgcccggctacttccgggccgcttacgatgccgtacgctcctccggcggcctctgc
atcgccgacgaggtccaggttggcttcggccgcgtgggcacccactactgggccttcgag
acccagggcgttgtcccggacattgtgtgcgtggccaagcccatgggcaacggccatccc
gtgggcgctgtggtcaccaccccggagatagcgcaggcattccacgccaccggagtggcc
tacttcaatacgtacggcggcaatccggtgtcctgtgccattgccaatgccgtgatgcgg
gtcatcgaccaggagggactccagcagaatgccctccagttgggcgactacctgctgcgg
gagtgcagccacctcaagcaggagttcgagtgcatcggcgatgtgcgcggcgtcggactg
tttgtgggcatcgagctggtaaaggatcgggagggacgcatacccgacaccaagtccgcc
cgctgggtggtcaatcggatgaagcagctccaccaggtgctggtcagctcggacgggccc
aacgacaacgtgatcaagctaaagccgcccatgtgcttcagccgcgagaacgccgacgag
ttccttctggccttccgcgagtgcctcgccaccctcacccaggacaagttggccacggag
gcggcgacagccgctgccaccaccacccatggggtcatcgccaccgccgcagagacgctg
gcgaataagacgaagctcttcgagcggcaggatcgcctcataaagtcggtctga

DBGET integrated database retrieval system