KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA27615
Entry
Dpse_GA27615      CDS       T01032                                 
Name
(RefSeq) uncharacterized protein, isoform A
  KO
K02943  large subunit ribosomal protein LP2
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Dpse_GA27615
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dpo03011]
    Dpse_GA27615
Ribosome [BR:dpo03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    Dpse_GA27615
SSDB
Motif
Pfam: Ribosomal_60s DUF1456
Other DBs
NCBI-GeneID: 6899833
NCBI-ProteinID: XP_002135702
FlyBase: FBgn0248980
UniProt: A0A6I8W9E4
Position
Unknown
AA seq 114 aa
MRYVAAYLLAVIGGKEAPANADLEKILSSVGIEVDTERLSKVIKELDGKSIEDLIKEGRE
KLSSMPVGGGAVSAAPSAGTPAAPAGGDKKEASKDEKKEDSESEDDDMGFALFE
NT seq 345 nt   +upstreamnt  +downstreamnt
atgcgttacgtggctgcatacttgttggctgttatcggcggaaaggaagcccccgctaat
gcagaccttgagaaaattctcagctctgtcggtattgaggtggatactgaacgtctttca
aaggtgattaaggaactcgatggcaaaagtattgaagatctgatcaaggaaggacgtgaa
aagctgtcttcgatgccagtcggcggcggtgctgtatctgctgctccgtccgcaggcact
ccagcagctccagctggtggggacaaaaaagaagctagcaaagatgagaagaaggaagat
tccgagtctgaggatgacgacatgggtttcgctctctttgagtaa

DBGET integrated database retrieval system