KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA28926Help
Entry
Dpse_GA28926      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo00450  Selenocompound metabolism
dpo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Dpse_GA28926
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dpo03016]
    Dpse_GA28926
Enzymes [BR:dpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     Dpse_GA28926
Transfer RNA biogenesis [BR:dpo03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    Dpse_GA28926
 Prokaryotic type
    Dpse_GA28926
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-GeneID: 6902435
NCBI-ProteinID: XP_002132981
FlyBase: FBgn0250285
UniProt: B5DJB1
Position
4
AA seq 409 aa AA seqDB search
MSDNSSASDSELEGIFHDVPICPFDPNVHELDADFRLTRFGDLNERSKKTPKELLTKLMM
NIAPREELEAGGEEVEPVPASQQQQQQQPLVSGFDISNHGSDVTLKNPLLNDLHLVKTTD
FVYPLIDDPYLMGKIACANVLGDLYAKGVVACDNMLMLLAVSTLMSEKERDTIVPMMMRG
FKDCAVKAGAHVTGGQSVVNRWCIIGGVATSVCENIEIIGPGNAVPGDVLLLTKPLGTHV
ALNVHKWMVSEDRKWKHLKNSYAKEDIAKAHDIAVRSMCRLNRTAAQLMHKYGAHGATVI
AEYGLVGDAEALAARQQMEVSFSIYNMPVIEKMASVASSCRDVFQLMRGRAPEHSGGLLI
CLPREEATAFCKEVIELEGPSARAYIIGIVEKGDRTVNLIKPRVIDAKI
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacaattcatctgcatccgattcggagctggaaggcatttttcacgacgtaccg
atttgcccctttgaccccaacgtccacgaactggatgccgattttcgtttaacacgtttt
ggcgacctgaacgagcgtagcaaaaagacgcccaaggaactgctcaccaaactgatgatg
aacatcgcacctcgcgaggagctggaagctggaggtgaggaagtggagccggtgccggcc
tcgcaacagcagcagcagcagcagccgctggtgtccggattcgacatcagtaaccatggc
tctgacgttacactaaaaaatcctttgctgaacgacttacatttggtgaagaccaccgac
tttgtctacccgctcattgacgatccctacttaatgggcaagatagcgtgcgccaatgtg
ctcggcgatctgtacgccaagggcgttgtggcctgcgacaatatgctgatgctgctggcc
gtgagcactctcatgtcggagaaggagcgcgataccatagtccccatgatgatgcgaggc
tttaaggactgcgcagtaaaggccggcgcccatgttactggcggccagagcgtggtcaat
cgctggtgcatcattggcggcgtggccacgtccgtctgcgagaatatcgagatcattggg
ccgggcaacgctgttccgggcgatgtcctgctgctgaccaagcccctgggcacacacgtg
gctctgaacgttcacaagtggatggttagtgaggacaggaagtggaagcacctgaagaac
tcctacgccaaggaggatatcgccaaggcccatgacatagctgtgagatccatgtgtcgc
ctcaatcgcaccgccgctcaactgatgcacaagtatggcgcccatggggccaccgtcata
gctgaatacggtctcgtgggtgatgccgaggccctggctgctcgccaacagatggaggtt
tccttttccatctacaacatgccagtgatcgaaaagatggcatcagtagcttcaagctgc
cgcgatgtcttccaactaatgcgtggacgggcccccgagcattccggcggtcttctgatc
tgcttgccccgtgaggaggccaccgcattctgcaaggaagtcattgaactggagggtccc
agtgctcgtgcctatatcattggcattgtggagaagggggaccggactgtcaatttaatc
aagccacgcgtcatcgatgctaaaatataa

DBGET integrated database retrieval system