KEGG   Drosophila pseudoobscura pseudoobscura: Dpse_GA29320Help
Entry
Dpse_GA29320      CDS       T01032                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
dpo  Drosophila pseudoobscura pseudoobscura
Pathway
dpo00250  Alanine, aspartate and glutamate metabolism
dpo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpo00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Dpse_GA29320
Enzymes [BR:dpo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Dpse_GA29320
Peptidases [BR:dpo01002]
 Cysteine Peptidases
  Family C44
   Dpse_GA29320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 NAD_synthase
Motif
Other DBs
NCBI-GeneID: 6900934
NCBI-ProteinID: XP_002134727
FlyBase: FBgn0250678
UniProt: B5DPA2
Position
XR
AA seq 563 aa AA seqDB search
MCGIFAIFSRDSKPVGTQVLHGSKHSLREMAYRQSGKQRHRGPDSTGVHVIAEDGVAMVH
ERLRIVGVERGDQPFVSNDGNVVLVANGEIYNYLELSAEIAKRLGTYKPKSDCHVILELY
EVYGEDLLSHITGMFAFALYDKRTKQVLLARDPFGIIPMYIGEDKAGNMWVASEMKCLVD
TCSKVETFTPGEARFGRVGEMRTFRHFQQSWIKELPTNPCDLKLLRSSLESAVRTHLHCD
VNFGALLSGGVDSSLIAAIATKIMREKDPYYRLKTFSVGLADAPDFKAARHVAKYIGSDH
KEIVFQIDEALDGIRDIVYHLETYDVTTVRCSLPMLLLTRYIKSTGIKMILSGEGADEIF
GGYLYFHKAPNCEQFHQELVKRVQQLHLSDCLRANKVAMAKGVELRVPFLDTGFVNHVMQ
IRPQDKIPGELNAFAEALGPLRRIEKYVLRAAFTENYLPDDVLWRQKEQFSDGVGYDWID
SIRRVATSHVGDEEFAEATRRFPFNTPTTKEAFYYRSIFEEQFPVEGAARTVVRWVPRLD
WGCPEDPSGRAQAVHQVNKDAII
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatttttgcaatattttcaagggattcgaagcctgttggcacgcaggttctg
cacggcagcaagcatagtctgcgcgagatggcctaccgccagagtggaaagcagcggcat
cgtggccccgactctactggcgtccatgtcatcgcagaggatggtgtggccatggtccac
gaacgtctgcgcattgtgggtgtggagcggggtgaccagccgtttgtgtccaacgatggg
aacgtggtgctggtggccaacggagagatctacaactacctggagctgtcggcggagata
gcaaagcggcttggaacctacaagccgaagagtgactgtcacgtcatcctggagttgtac
gaggtctatggggaggatctactgagccacatcaccggaatgttcgccttcgccctgtac
gacaaacgcacgaagcaagtgctccttgccagggatccctttggcatcattcccatgtac
atcggcgaggataaggccggtaacatgtgggtggcctccgaaatgaagtgcttggtggac
acttgtagcaaagttgagacgtttacgccgggcgaagctcgcttcggacgcgtgggagag
atgcgaaccttccggcactttcagcaatcctggatcaaggaacttcctaccaacccttgc
gacctgaagctactccgttccagcctggagtcggcggtgcgcacacatctccactgcgac
gtcaactttggggctctgctgtcggggggcgtggactccagcctgattgccgcgatcgcc
acgaagatcatgcgggagaaagacccttactatcgcctgaagaccttctctgtgggtctg
gccgatgcgcccgattttaaggcggcccgccacgtggccaagtacatcggcagtgaccac
aaggagatcgtctttcaaattgatgaggccctagacgggatccgcgatattgtctatcac
ctggagacctatgacgtcaccactgtgcgctgcagcctgccaatgctgctgctgacccgc
tacatcaagagtaccggcatcaagatgatcctctccggcgagggggcggacgagatcttc
ggcggatacctgtacttccacaaggcccccaactgcgagcagttccaccaggagctggta
aagcgcgtacagcagctacatctctccgactgcctgcgcgccaacaaggtggcgatggcc
aagggcgtggagctgcgcgtacccttcctggacacgggcttcgtcaatcatgtgatgcag
atccggccccaggacaagattcctggcgagctcaacgcgtttgccgaagccctaggaccc
ttgaggcgcattgagaagtacgtgttgcgggctgccttcaccgaaaactatttgccggac
gacgtgctttggcgccagaaggagcagttttccgacggcgtcggctacgactggattgat
agcatccgccgtgtggccaccagtcacgtgggagacgaggagttcgccgaggctacccgc
agattccccttcaacacgcccaccacaaaagaggcattctactatcgaagcatcttcgag
gagcagttcccggtcgagggagcggcccgcacggtggtcaggtgggtgccacgcctggat
tggggctgtccggaggacccctcgggacgggcacaggccgtccatcaagtcaataaagac
gctataatttaa

DBGET integrated database retrieval system