KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_12105Help
Entry
DICPUDRAFT_12105  CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K11252  histone H2B
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Brite
Chromosome and associated proteins [BR:dpp03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    DICPUDRAFT_12105
Exosome [BR:dpp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   DICPUDRAFT_12105
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa DUF4364 CENP-T_C
Motif
Other DBs
NCBI-GeneID: 10508605
NCBI-ProteinID: XP_003292653
JGI: Dicpu1_12105
UniProt: F0ZZ13
Position
Unknown
AA seq 131 aa AA seqDB search
ENKEKAVTPKVTKTAADGEKKKTKRKKSDYTSFSTYIHKLLKQITPSTGKSENKKFTISS
KAMAVMNSFVHDIFERIANEAGGLAKKKKRHTLHSRDIQVAVRIILTGELAKHAILQGMT
AVNKYHPQSSE
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
gaaaacaaagaaaaagctgtaactccaaaagttaccaagaccgccgctgatggtgaaaag
aaaaaaaccaaaagaaagaagtctgattacacctctttctcaacttatatccacaagtta
ttaaaacaaattaccccatccaccggtaaatctgaaaacaagaaattcaccatctcctca
aaagccatggccgttatgaactcattcgtccacgatatcttcgaacgtatcgccaatgaa
gctggtggtttagccaaaaagaaaaagagacacactctccactctcgtgatatccaagtt
gctgttcgtatcattttaactggtgaacttgccaaacacgctattcttcaaggtatgact
gctgtcaacaaataccatccacaatcatcagaa

DBGET integrated database retrieval system