KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_147138
Entry
DICPUDRAFT_147138 CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp00100  Steroid biosynthesis
dpp01100  Metabolic pathways
dpp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dpp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    DICPUDRAFT_147138
Enzymes [BR:dpp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     DICPUDRAFT_147138
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 10509400
NCBI-ProteinID: XP_003283457
JGI: Dicpu1_147138
UniProt: F0Z7R6
Position
Unknown
AA seq 269 aa
MEALPFSQDFSFDDDYQGKRHGNIIHDLFLGVELNPRFAGLDLKFFSLRPALMGWIMVNF
SLAAQEYKVYNSLSSGMILYQIFTFIYAFDYFFFEECMLSTWDIIAENWGWMLIWGDYVW
ITFAFAVQPWFLIYNRVHLTLIQMIVISTIFAIGFYVFRCANSQKHQFKTNPKALIWGKK
PETIGGKLLVSGFWGILRKPNYLGDWIVAFSFSFPCLFNTPLVYLYPMYLVILNSHRQYR
DHQKCSKKYGELWKEYCRRVPYVVLPYLI
NT seq 810 nt   +upstreamnt  +downstreamnt
atggaagctttaccatttagtcaagatttttcctttgatgatgattaccaaggtaaaaga
catggtaatatcatccatgatttatttttaggtgttgaattaaatccaagatttgctggt
ttagacttaaagttcttttcattaagaccagctttaatgggatggatcatggttaacttt
tcattagccgcccaagaatacaaagtttacaattcattatcaagtggtatgatcctttat
caaatcttcacatttatttatgcctttgattactttttctttgaagaatgtatgttatca
acatgggatatcattgctgaaaactggggttggatgttaatttggggtgattatgtttgg
attacttttgcatttgctgttcaaccatggttcttaatttataacagagttcacttaact
ttaattcaaatgattgttatttcaactatttttgctattggtttctatgttttcagatgt
gccaattcacaaaaacatcaattcaaaaccaatccaaaagctttaatttggggtaaaaaa
ccagaaactattggtggaaaattattagtttcaggtttctggggtattttaagaaaacca
aattaccttggtgattggatcgttgctttttcattctcattcccatgtcttttcaacact
ccacttgtttatctttatccaatgtatttagttatcctcaattcacatcgtcaatacaga
gatcatcaaaaatgttcaaagaaatatggtgaactttggaaggaatattgtagacgtgtt
ccatatgttgttttaccatatttaatttaa

DBGET integrated database retrieval system