KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_148855Help
Entry
DICPUDRAFT_148855 CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K06691  26S proteasome regulatory subunit N13
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp03050  Proteasome
Brite
KEGG Orthology (KO) [BR:dpp00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    DICPUDRAFT_148855
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:dpp03051]
    DICPUDRAFT_148855
Proteasome [BR:dpp03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     DICPUDRAFT_148855
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Proteasom_Rpn13 RPN13_C GET2
Motif
Other DBs
NCBI-GeneID: 10507182
NCBI-ProteinID: XP_003285000
JGI: Dicpu1_148855
UniProt: F0ZC64
Position
Unknown
AA seq 305 aa AA seqDB search
MSTPDDIEFKAGKAQLVDKTVTSDNRKGFLKFNVTGDGLILVSWRPRDSSAYEDEFYFAP
GELKFVKVEACKTGRMYYLNFSDSNHKEFFWLQEPDASKDAKIEKAIKLIEDFVPMDDDQ
MPIDSTPAPNQTSTQPTAPTKQPETKTNNTATPAPSSTGYISTPSQSVNKSSATTSETPS
QIPNMDLFKDIFSKLPAQPKQPQVTLGKIMTAENLIPFLRDNPSIKQDLLQHLPEECAQD
PSKLNEILYSPQFLQSLETLDYAIFEGHGAEIISLLGYEPTLASQRGVEGFLTNIQEECK
KKQKK
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaccccagatgatattgaatttaaagctggtaaagctcaattagttgataaaact
gttacatcagataacagaaaaggtttcttaaaattcaacgttacaggtgatggtttaatt
cttgtttcatggagaccacgtgactcatcagcatatgaagatgaattttattttgcacca
ggtgaacttaaatttgttaaagttgaagcttgtaaaactggtagaatgtattatttaaat
ttttcagattcaaatcataaagaatttttctggttacaagaaccagatgcctctaaagat
gctaaaattgaaaaagcaattaaattaattgaagattttgttccaatggatgatgatcaa
atgccaattgactcaacgccagctccaaaccaaacctctacacaaccaacagctccaact
aaacaaccagaaaccaaaaccaataatacagctacaccagcaccatcatcaacaggatat
atttcaacaccaagccaatctgtaaataagtcaagtgcaaccacatcagaaacaccatca
caaataccaaatatggatttatttaaggatatattttcaaaacttccagcccaaccaaaa
caaccacaagttacattaggtaaaataatgactgctgaaaatttaattcctttccttaga
gacaatccaagtatcaaacaagatttattacaacatcttccagaagaatgtgctcaagat
ccaagcaagctaaatgaaattttatattctccacaatttcttcaatcattagaaacactc
gactatgctatttttgaaggtcatggtgctgaaattatatcattattaggttatgaacca
actttagcttcccaaagaggtgtcgaaggttttttaacaaatatacaagaggaatgtaaa
aaaaaacaaaaaaaataa

DBGET integrated database retrieval system