KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_152073Help
Entry
DICPUDRAFT_152073 CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp00450  Selenocompound metabolism
dpp00970  Aminoacyl-tRNA biosynthesis
dpp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    DICPUDRAFT_152073
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DICPUDRAFT_152073
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dpp01007]
    DICPUDRAFT_152073
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dpp03016]
    DICPUDRAFT_152073
Enzymes [BR:dpp01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     DICPUDRAFT_152073
Amino acid related enzymes [BR:dpp01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   DICPUDRAFT_152073
Transfer RNA biogenesis [BR:dpp03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    DICPUDRAFT_152073
 Prokaryotic type
   Other AARSs
    DICPUDRAFT_152073
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f tRNA-synt_1c
Motif
Other DBs
NCBI-GeneID: 10501149
NCBI-ProteinID: XP_003287898
JGI: Dicpu1_152073
UniProt: F0ZKE7
Position
Unknown
AA seq 566 aa AA seqDB search
MFKLTNYIRNNKSLLNKINNKYYCTTTTNAINKKKILITTPIFYVNGPPHIGHLYTALLG
DAFARWNRFKGNDTYFMTGTDEHGMKVDEAAKKKGLKTIDYCDSISNRFKELFKLSEIQY
DDFIRTTEPRHRDAVTAMWNRLLEKGYIYKGVYKGWYCTSDESFLTDDQVMEGMSPITPN
NPVSKKCMVSKESGHEVTWVEEENYMFKLSEFASKVENWIQDLNPIFPATHTKQLLAMIS
QGVRDLSISRPSSRITWGIPVPNDPSQTIYVWLDALTNYLTVTGYPKVDPNDPSSYWSNT
HHIIGKDIIKFHCLYWPSFLMAAEYPVQKGVLCHAHWTVNREKMSKSRGNVVDPFESIQN
YGLEVIRYFLLKGGGLEDDGDWSDHEISVRLKADLADTYGNLLSRCTGKPLHPSGHWPKS
VNLDESSTLLTEKDIQLLNHCKKLINGATVNFDKGDFKNGIYEILAFLYDCNGYIQEQKP
WTLAPKPNRPNADPVRLNTIMYIALEMIRIASLLLLPVIPSSATLALNQLDIPLDQRNHQ
NLKLGYDYFSRENNQIPQNSLILFKK
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaattaacaaattatataagaaataataaaagtttgttaaataaaattaataat
aaatattactgtaccaccactacaaatgcaatcaataaaaaaaaaatattaattaccaca
ccaattttttatgtcaatggaccaccacacattggtcatttatatacagctttgttaggt
gatgcatttgcaagatggaatagatttaaaggaaatgatacatactttatgacaggtaca
gatgaacatggtatgaaagtggatgaagcagcaaaaaagaaaggtttaaaaactattgat
tattgtgatagcatctcaaatagatttaaagaattattcaagttatcagagattcaatat
gatgattttattagaactactgaaccaagacacagagatgctgttacagcaatgtggaat
agattattagaaaagggatatatttataaaggtgtatataaaggatggtactgtacttca
gatgaatctttcttaacagacgatcaggttatggaaggtatgtcaccaataaccccaaat
aatccagtcagtaaaaagtgcatggtaagtaaagagtctggtcatgaggttacttgggtt
gaagaagaaaactatatgtttaaattatcagaatttgcatcaaaagttgaaaactggatt
caagacttaaatccaatatttccagccacacataccaaacaactattggcaatgatttct
caaggtgttagagatctctccatctcaagaccatcttcacgtattacatggggtattcct
gtaccaaatgaccctagtcaaactatttatgtttggttagatgcactcacaaactattta
actgttactggctatccaaaagttgacccaaatgatccatcatcctattggtccaatact
catcacatcattggtaaagatatcattaaattccactgtctatattggccaagtttttta
atggctgccgaatatcctgttcaaaaaggtgttctttgtcatgcccattggactgtaaat
agagaaaaaatgtcaaaatcacgtggtaatgttgtagacccattcgaaagtattcaaaac
tatggtttagaggtcatcagatactttttacttaagggtggtggtttagaagatgatggc
gattggtcagatcacgaaatttcagttcgtttaaaagcagatttagcagatacttatggt
aatcttttatcaagatgcacaggcaaaccactccatccatcaggtcattggccaaaatca
gttaatcttgatgaatcctcaacattactcactgaaaaagatattcaacttttaaaccat
tgtaaaaaattaattaatggagcaactgtcaatttcgataaaggtgatttcaaaaatggt
atttacgaaattctagcattcctctacgactgcaacggctatattcaagaacaaaaacca
tggacattagcacccaaaccaaatcgtccaaatgcagacccagttcgtttaaacactatt
atgtacattgcattagaaatgatccgtattgcctcattactcctcttacctgttattcca
tcctctgccacattagctctcaaccaactcgacattcctttagatcaaagaaatcaccaa
aacctaaaattaggttatgattatttctctagagaaaacaatcaaataccacaaaactct
ttaattttatttaaaaaataa

DBGET integrated database retrieval system