KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_152501Help
Entry
DICPUDRAFT_152501 CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:dpp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dpp04131]
    DICPUDRAFT_152501
Membrane trafficking [BR:dpp04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    DICPUDRAFT_152501
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398
Motif
Other DBs
NCBI-GeneID: 10501704
NCBI-ProteinID: XP_003288286
JGI: Dicpu1_152501
UniProt: F0ZLI8
Position
Unknown
AA seq 2389 aa AA seqDB search
MGISTEDNNNNNINNNNNGNNNNNKNNDESLNSIRVEIKNDESATKKQDVQLTESSQTTE
QPTADSTTPEPSDSSTPNLTGSAASPLSKSQQKDLNESQTTRDLSLSNQFSNTLTDSQTA
DTHTISSVPNSPLAEDSPELTQSIDLNQRQEISPPSISPDRPHSPISLDDGVNNNNNNNN
NDEQNTSTESLNSLVKPPQNPRIQLINNGGSSNKSSSSLEAHKYRNFFGNKLQTPSVKDD
PLADDMIHLPKDDLQFTRSELYHRVISTGMSLPPGVPTVFFNPLEYNQHIKTSIDTFNAP
RKTITRNYEKFKKDQDRLSLINPEMIERYECDLVYERELAQSKLSQSQSTPPPSIHSSRN
SGGILDERDIPQLWVESGDDLHFEYQAPITSNTDEENSESRKKQRLALFKYFKPDYNWGS
GTEVSLCSRTPVEPWKKPSSTSVLIEFKGLVFLLGEHEPFYCQMFLYDSVNKTRLSEVYH
FDFNSERLKQIIDNKESEDTPDYLTQCKHVLVSLPHKQTKDVWIVVRVNKIMQGEPDLIK
EPYTRLDEKETSKSRVKVSTTIQDIGKRLGRFHQSFSITALPLTNENGSVKVGSHECDLY
RQVPKDLSDLQDLISDLRDSSKKKKLKTLLGAFTCIIHKTEGDLPPYGQRLDPSYNFIKA
SEPYNHPSPIDSNKSYNNVPTNLNNNNNNSPSTTSTTTTTTTTTTTTTTSDLLLQKLNES
PTITVTPDGTPPLKSVQSAASILSLSSNDAFTPPSPSLNGLEDSPALSPRRQLQHSSSYS
NSIKRNQTLISLAPVIPAIREVQCFSKFPELIPHNQLFNNLYIYPDTANLNKAHGRNITI
KIEIREDDILSNPPLKFIYGKSSGQRFTNVFYTETHYHTKNPLFIDEIKIKLPPILPPKL
HILFTFYHVVCKVGKRDESSDNIIGFSTFPLYREKKFVDNGQQGLQLAVGHPKDKYLMKF
SEDYTLLENGKTIFKFDLKLLSSIYPQNTHINRFLLYSKDDLLSDKDLTQILNQFILFDP
LESIKFFPVIMNHLLFVICNRESTVGSTAIKALLILLTKIQNILEDSNIRVPFLSSYINH
YFDNPQDTKIPVHTALCQRLVLFLMRKRSNDFADISNSSIFSFSWFIYDLIVKSIGLYKL
DGKTPIKDGATSPSAPFFEIHDPEFIKFIPKLVSFGLSHILGAVSQNNDCRLASDANNNL
ALFIRDLFSVFDRGVVVDLLFTFLNDMNQGISKDILNATTFLFYKFHFLKIICDYEHYIN
LNVPTLYSITNIQSLSNKIKNSHPISGILIREVLDIIFQGNHSAEVRNIAFSTLNTILTK
HDYDQRYQSQAKKERIASIYFPLVLELIDHQDRFNSWFSANVSDISEKRLFISCVLFVLK
NLSKQLLKQWFNKEVPQRLNILFEILAQFATAFEYQQIKDQSSGPEILTSPALINSSSNG
SSSVLPISSSGKLSKDLLMRKGTTSLSPQKFDSQLNLVRSSSSAVFMKDQNSPSSIGQSS
SSLLKQQLQQQAQQAAAQQTQTQPLSPSSSLQPQPISISSSFSNDLLTAFANAPIKEASN
SPYFSPGLSTQYLGVPPPPPPPQTSNESSSTGSRSNRSSFNGSIGIPMMNGSTGMAPPYT
KKTVPPNEPVLTAEANLIILDFVEDFIKYQYPILKEINSPVFEKLFQLIITLLSKKQSHR
VTHCLFASLRSFVHKFRKHFFKDNSNNYCNLLCSEILRYCNFPSKEIRAVSTSFFYSMIK
LNNHMVGNFGRMKIQATIALSNLASSGVFKNDFKNLERSFYTLSKYSSTDIARVESDSSI
ISQELLETLSTREEIFNVKKLFSDNIQKMSLKLSKIIRDTVRVNLLKANSDPETIHELFS
EIAAGYSDTPLIRAKWLNLLSVKHVEEENYFEAAVCKLRIALLIISHLEQTQKLPCPLDL
SIFDQICPGMKETVIEEDEGVYQSTNFSAADLISNVSLATNQLRMGEYFEYSILLYKLLM
PLYEKSRDFVNLSECHKHITDLYKEIIKAIENKSRMLGRYYRVGFYGDAFEDLDGQEFIY
KEPKLTHLFVLSERLKTFYREKFHQEVVVFPDSGKIERSSLDPTRLYLQITSLKPYFSND
FVDSRPDYFERHTLLKNFVFITPFTLNGRTQGSITEQFHRKTILTIENTAPNMLKRYMVI
SKKEIEISPIENSIETIQQRNNLLSIEINQSPPNIKTLQGVLQGSVLLQVNAGALEICRG
FLANQMRSNWPAHHVDKLAQECSRFLKLCKMALDINKYRIQMNQYSFHQELESGYNKLSF
KMERYIKGEIANEQDEEIIDQDQQAETVHSSYGIEDESSLITDLSYDDDISIKESSPNNL
LDNFLPNLKKKTNGHLTIKEDKRIKRGSAEFDYSIQTPRSIDKKSINNH
NT seq 7170 nt NT seq  +upstreamnt  +downstreamnt
atgggtatatctacagaagataataataataataatattaataataataataatggtaat
aataataacaataaaaataatgatgaatcattaaatagtatcagagtagaaattaaaaat
gatgaatcagcaacaaaaaaacaagatgttcaacttacagagtcatcacaaacaactgag
caaccaactgctgattcaaccacaccagagccatcagattcatcgacaccaaatctaaca
ggttcagccgcatcaccactttcaaaatctcaacaaaaagatttaaatgaatcacaaact
acaagagatttatccctatcaaaccaattttcaaacaccttaacagattcacaaacagcc
gatacacatacaatatcatctgtaccaaattcaccattagcagaagattcaccagagtta
acacaatcgatagatttaaatcaaagacaagaaatttcaccaccatctatttcaccagat
agaccacattcaccaatatcattagatgatggtgttaataataataacaataataacaat
aatgatgaacaaaatacgagcacagaaagtttaaattcattagtgaaaccacctcaaaat
ccaagaattcaattaataaataatggtggatcatctaataaatcaagctcaagtttagaa
gcacataaatatagaaatttttttggaaataaattacaaaccccaagtgttaaagatgat
ccattggcagatgatatgatacatttaccaaaagatgatttacaatttacaagatcagaa
ctttatcatagagttatatcaactggtatgtccttaccaccaggtgtcccaacagtgttt
ttcaatcccttagaatataaccaacatattaaaacatcaatagacacatttaatgcccca
agaaaaaccattacaagaaactatgaaaaattcaaaaaagatcaagatcgtcttagtctt
attaacccagaaatgatagaaagatatgagtgtgatttggtttatgaaagggaattggcc
caatcaaaattgtctcaatcacaatcaacacctccaccatcaattcattcatcaagaaat
agcggcggtatattggatgaaagggatatacctcaattatgggtagagtctggtgatgac
cttcactttgaatatcaagcaccaataacatcaaataccgacgaagaaaactctgaatct
cgaaaaaagcagcgtttagctttatttaaatattttaaaccagactacaactggggctca
ggtacagaggtatctttatgctcaagaactccagtagagccatggaaaaagccatcctca
accagtgttttgatagagtttaaaggattggtatttttattgggcgaacatgaaccattc
tattgtcaaatgtttttatatgattcagtcaataagaccagactatcagaagtataccat
tttgatttcaattctgaacgtttaaaacaaattatagataacaaagaaagcgaagataca
ccagattatttaactcagtgtaaacatgtattagtatcattaccacacaaacaaacaaaa
gatgtttggatcgtagttagagtaaataaaattatgcaaggcgaaccagatctcatcaag
gaaccatacaccagattagatgaaaaagaaacatcaaaatcaagagttaaagtctcaaca
actattcaagatataggtaaacgtttaggaagattccatcaatcattctccattaccgcc
cttccattaacaaatgaaaatggtagtgtcaaagttggtagccatgaatgcgatctttat
agacaagtacctaaagatttatccgatcttcaagacttaatctctgatcttagagattct
tcgaaaaaaaagaaattaaaaactttattaggtgcctttacttgtataatacataaaacc
gaaggtgatttaccaccttatggtcaacgtctagatccatcttataattttattaaagct
tcagaaccatataatcatccttcaccaattgattcaaacaaatcttacaataatgtacca
acaaatttaaataacaataataataattcaccatcaactacctcaaccaccacaaccacc
acaaccactacgactacaaccactacttcagatttactattacaaaaattaaatgaatca
ccaactatcacagttacaccagatggcacacctccactaaaatcagtccaatcagcagct
tcaattttatcattatcatcaaatgatgcatttacacccccatcaccatcattaaatggt
ttagaggattcaccagcactctcaccaagaagacaattacaacattcaagctcttattca
aatagtatcaaacgtaatcaaactttaatatctttagctccagtcattccagcaattcgt
gaagttcaatgtttttccaaatttccagaattaatcccacataatcaattatttaataat
ttatatatttacccagatactgcaaatttaaataaagcccatggtagaaatattacaatc
aaaatcgaaattcgtgaagatgatatcttgtcaaatccaccactcaaatttatttatggt
aaaagctcaggtcaaagattcactaatgttttctacactgaaactcattaccacactaaa
aaccccctatttattgatgaaattaaaattaaattacccccaattttacctccaaagcta
cacatattattcacattttatcatgtagtttgcaaagttggtaaaagagatgaatcatca
gataatataattggtttttcaacttttcctttatatagagaaaagaaatttgtagacaat
ggtcagcagggtcttcaattagcagtaggtcatccaaaagataaatatttaatgaagttt
agtgaggattatacattattagaaaatggtaaaactatattcaaatttgatcttaaatta
ctctcaagtatctacccacaaaatacccatatcaacagattcttattatactcaaaggat
gatttactcagtgacaaggatttaactcaaattttaaaccagttcatattatttgatcca
ttagaatcgataaagttcttcccagttattatgaaccatcttttatttgtaatttgcaat
agggaatcaacagttggtagtaccgccattaaagcattgcttattttgcttactaaaatt
caaaatatactagaagattcaaatatacgtgtaccatttttatcatcatatatcaaccat
tatttcgacaatccacaggatactaaaattccagtccatactgcattatgccaaagatta
gttttgttcttaatgagaaaaaggtcaaacgattttgcagatatttcaaattcatcaata
ttttcattttcatggtttatttacgatttaattgttaaaagtattggattatataaactc
gatggcaagacaccaataaaagatggagcaacatcaccatcagcacccttctttgaaatc
cacgacccagaatttattaaatttattccaaagttggtgtcatttggtctttctcatatt
ttaggtgcagtttctcaaaataatgattgtagattagcatcagatgccaacaacaattta
gcactatttattagagatttattttcagtattcgacagaggcgtagttgttgacctttta
ttcacctttttaaatgacatgaaccaaggtatttcaaaagatatattaaacgcaacaaca
tttttattttataagttccatttcctcaaaattatttgcgattatgaacattacatcaac
ttgaatgtaccaactttatattcaattacaaatattcaaagcttatcaaataaaatcaaa
aattctcacccaatttcaggtattttaattagagaggttttggatattattttccaaggt
aatcattctgcagaggtcagaaatatagctttttctacacttaatacaattttaaccaag
cacgactatgaccaacgttatcaatctcaagcaaaaaaagaaagaattgcttctatttat
ttcccattggttttggaattaattgaccatcaagatagatttaacagttggtttagtgca
aatgtttcagatatctctgagaaacgtttgtttatttcttgtgtactatttgttttgaaa
aatctttcaaagcaactattaaaacaatggttcaacaaagaggttccacaaagattaaat
atcctctttgagattttagctcagtttgcaaccgcttttgaataccaacaaattaaagac
cagtcaagcggtccagaaattttaactagcccagctttaatcaattcaagttctaatggc
agctcatcagttttaccaatttcatcatctggtaaattatctaaagatttattaatgaga
aagggtaccacttcgctatcaccacaaaaattcgattcgcaattaaatctagtcagaagc
agctcaagcgctgtatttatgaaggaccaaaattcaccatcatcaattggccaatcttct
tcgtcacttttaaagcaacaattacaacaacaagcccaacaagctgctgcacaacaaaca
caaactcagccattatcaccatcatcatcgctacaacctcaaccaatttccatctcctcc
tcatttagtaatgatttattaactgcttttgccaatgctccaatcaaagaggccagtaat
tcaccatacttttcacctggtttatcaacacaatatttaggtgttccacctccaccacct
ccaccacaaacatcaaatgaatcttcatccacaggtagtcgtagtaatagatcatcattt
aatggtagtatcggtattcctatgatgaacggctctactggtatggctccaccctatacc
aagaagactgtaccacccaatgaaccagttttaacagctgaagccaatttgataatttta
gattttgtcgaagattttataaaataccaatacccaattcttaaggaaattaactcccca
gtatttgaaaagctcttccaattgattattaccttgttatccaaaaagcaatcacatcgt
gttacccattgtcttttcgcctcactccgttcatttgtacacaaattcagaaagcatttc
tttaaagacaactcaaataactattgtaatcttttatgctctgaaattttacgttattgc
aatttcccatcaaaagaaatcagagcagtctcaacaagcttcttttattcaatgattaaa
cttaataatcatatggttggtaactttggtcgtatgaaaattcaagctactattgcctta
tcaaatttagcaagttcaggtgttttcaagaatgattttaaaaatttagagcgttcattc
tatactctttcaaaatattcatctaccgatatcgccagagttgaatctgatagctctata
atttcacaagagttacttgaaactctttctaccagagaagagatattcaacgtcaagaaa
ttatttagcgataatattcaaaagatgagccttaagctctcaaagattatccgtgataca
gttagagttaatttattaaaagcaaactctgacccagaaactattcacgagcttttctct
gagattgccgcaggttattcagatactccacttattagagccaagtggttaaatctttta
tcagtcaaacatgttgaggaagaaaattatttcgaagcagcagtatgtaaacttagaatt
gcactattaatcattagtcacttagagcaaactcaaaaacttccatgtccattagatctc
agtatattcgatcaaatatgcccaggtatgaaagaaacagtcattgaagaagatgaaggt
gtttatcaatcaaccaatttctctgcagctgatcttatttcaaatgtttcacttgcaacc
aatcaattgcgtatgggtgaatactttgagtactctattctattgtacaaacttttaatg
ccactttatgaaaagagtagagattttgtaaatctctcagagtgtcacaaacatattacc
gacctttacaaagaaattattaaagcaatcgaaaataaatcacgtatgttgggcagatac
tatcgtgttggtttctatggtgatgcattcgaagacttggatggtcaagaatttatttat
aaagaaccaaaacttacccatcttttcgtactttccgaacgtttgaagacattctatcgt
gaaaaattccatcaagaggttgttgtattcccagatagtggtaaaatcgaaagatcatca
ttggatccaactcgtctataccttcaaatcacatcattaaaaccatactttagcaatgac
tttgtagattctagaccagattactttgaaagacacacacttttaaagaactttgtattc
attactccattcacattaaatggacgtactcaaggctcaatcacagagcaattccacaga
aagactattcttactattgaaaacactgctccaaatatgttaaaaagatatatggtcatc
tcaaagaaagaaattgaaatttcaccaattgaaaatagtattgaaaccattcaacaacgt
aataatttactatcgatcgaaattaatcaatctccaccaaatattaaaactcttcaaggt
gtacttcaaggtagtgtactattacaggttaatgcaggtgctttagagatttgcagagga
tttttggccaaccaaatgcgttcaaattggccagcacatcatgtcgataaattggcacaa
gaatgttcacgtttccttaagctttgtaaaatggctttagatattaataaatatagaatt
caaatgaatcaatacagtttccaccaagaattagaatctggttataataaactatctttc
aaaatggaacgttacatcaaaggtgaaatcgccaatgaacaagatgaagaaatcattgac
caagatcaacaagccgaaactgttcattcttcttatggtattgaagatgaatcatcattg
attactgatttatcctatgatgatgatatctctataaaagaatcctctccaaataatctt
ttagataactttttaccaaaccttaaaaagaaaacaaatggccatttaacaatcaaagag
gataaaagaattaaaagaggctctgctgaatttgattattccattcaaacaccaagatca
attgataaaaaatcaattaataaccattaa

DBGET integrated database retrieval system