KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_154796
Entry
DICPUDRAFT_154796 CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K20756  physarolisin [EC:3.4.21.103]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:dpp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dpp01002]
    DICPUDRAFT_154796
Enzymes [BR:dpp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.103  physarolisin
     DICPUDRAFT_154796
Peptidases and inhibitors [BR:dpp01002]
 Serine peptidases
  Family S53
   DICPUDRAFT_154796
SSDB
Motif
Pfam: Pro-kuma_activ Peptidase_S8
Other DBs
NCBI-GeneID: 10504657
NCBI-ProteinID: XP_003290302
JGI: Dicpu1_154796
UniProt: F0ZSA3
Position
Unknown
AA seq 588 aa
MRNLLLLVLISVCLAVPALSFNRDSNWIQHNRAGKHEIVNFHVALNQRNLDVLESTLLDV
SNPESPNYGKYWDMESVLALVAPEQSVVDQVAQFLRNSGCQSIEVHSDFIKASAPVSAVE
KMFSVDMFNYKHAHKAGQTLVRSKQTYTLPKEIREHVHIVTGLSELPHLKNGPKAHKLNT
KASPSSDPGIVVPATIQGLYGIPTGYNNHKNTSLCLAEFSDDRSYNPKDLNTFASKTGTP
LINVVKNVGPFQPTNPDLESTLDVQYGGAIAETAQVWFWTVDGWMFEFSSALAEQYPAPY
IVSMSWGWPEPLQCESGIGNCQNGETSEQYVDRVNTEFQKIGLRGITLLAASGDQGAPGD
NNPSCNNKNKPISTIFPGASPWVTSVGATMLSAPSSSASGDNSDIPVCGIHHCATSTSEL
VCSYPAALITTGGGFSDYSPRPSWQSSVVETYLNSGVALPASNFFNSSNRGFPDVSALGH
NYYVVAGDQMQVVDGTSCSSPVFGAIVALLNSYRFNNNKSPLGFINPVLYAAAASNNNAF
TDITTGDNKCTEACCAKTGYLATKGWDPVTGLGTPNFKGLLAYVQTLQ
NT seq 1767 nt   +upstreamnt  +downstreamnt
atgagaaatttattactcttagtattaatttctgtttgtttagctgtcccagctttatca
ttcaacagagattcaaactggatccaacacaacagagctggcaaacatgaaattgtcaac
ttccatgttgctcttaaccaaagaaacctcgatgtcctcgaatccactttattagatgtt
tcaaacccagaatcaccaaactacggtaaatattgggatatggaatcagtccttgcttta
gttgccccagaacaatcagttgtcgatcaagttgctcaattcttaagaaacagcggttgt
caatcaattgaagttcacagtgatttcatcaaagcctctgctccagtctcagctgttgaa
aaaatgttctctgttgatatgttcaactacaaacatgcccacaaagctggtcaaacttta
gttcgttcaaaacaaacctacacccttccaaaagaaatcagagaacacgtccacattgtc
actggtctttctgaattaccacacttaaagaatggtccaaaagcccacaaattaaacacc
aaagcctcaccatcatcagatccaggtattgttgtcccagccaccattcaaggtttatat
ggtatcccaactggttacaataaccacaaaaatacctcactctgtttagctgaattctca
gacgatcgttcatacaatccaaaagatttaaatacttttgcctctaaaaccggtactcca
ttaatcaatgttgttaaaaacgttggtccattccaaccaactaacccagatttagaatca
actttagatgttcaatatggtggtgctattgccgaaactgctcaagtttggttctggacc
gtcgatggttggatgttcgaattctcatcagctcttgctgaacaatacccagctccatac
attgtctcaatgtcatggggttggccagaaccattacaatgcgaaagcggtattggtaac
tgccaaaacggtgaaacctcagaacaatacgtcgatcgtgttaacactgaattccaaaag
atcggtttacgtggtatcactttattagccgcctcaggtgatcaaggtgccccaggtgac
aacaatccatcatgtaacaacaaaaacaaaccaatttcaaccattttcccaggtgcctca
ccatgggttacttcagttggtgctactatgttatcagccccatcatcatcagcaagcggt
gacaacagcgatatcccagtttgcggtatccaccactgtgccacctcaacctccgaactc
gtctgttcatacccagctgctcttattactactggtggtggtttctcagactacagccca
cgtccatcatggcaatcaagtgtcgttgaaacctacttaaactcaggtgttgctttacca
gcttcaaacttcttcaactcatcaaacagaggtttcccagatgtctctgctttaggtcac
aactactacgtcgttgctggtgatcaaatgcaagttgtcgatggtacttcatgttcatca
ccagtctttggtgctatcgttgctttattaaacagctaccgtttcaacaacaacaaatca
ccactcggtttcattaacccagtcctctacgctgctgccgcctcaaacaataacgccttc
actgatatcaccactggtgacaataaatgtactgaagcctgttgcgctaaaactggttat
ttagccaccaaaggttgggatccagttactggtttaggtactccaaacttcaaaggttta
ttagcttacgttcaaaccctccaataa

DBGET integrated database retrieval system