KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_155275Help
Entry
DICPUDRAFT_155275 CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:dpp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    DICPUDRAFT_155275
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dpp03032]
    DICPUDRAFT_155275
   03036 Chromosome and associated proteins [BR:dpp03036]
    DICPUDRAFT_155275
   03400 DNA repair and recombination proteins [BR:dpp03400]
    DICPUDRAFT_155275
Enzymes [BR:dpp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     DICPUDRAFT_155275
DNA replication proteins [BR:dpp03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     DICPUDRAFT_155275
Chromosome and associated proteins [BR:dpp03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    DICPUDRAFT_155275
DNA repair and recombination proteins [BR:dpp03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     DICPUDRAFT_155275
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VIT PARP VWA_3 14-3-3 VIT_2 VWA Ribosomal_60s VWA_2 BRCT_2 BRCT WH2 RNA_pol_Rpb1_R
Motif
Other DBs
NCBI-GeneID: 10508364
NCBI-ProteinID: XP_003290740
JGI: Dicpu1_155275
UniProt: F0ZTJ5
Position
Unknown
AA seq 2350 aa AA seqDB search
MPSGFNNTQKKSNILNGNTFYLDCGPSSGYKIKKELQTFIESNGGLVSMILNQKVNYYVF
YGDFQDLVKVENNNDVNIEDLSFGIKKAIKLNIPIVSKRYLDDSASYGSLLSHDEYSLVS
KYNIKEYHYKSFDFSNLLGDNNNNDSGSENKNKKFDRIKYDEKSDLFPESKYHIVKHNIL
SKHDRLSDRFCCIELHVAGKSLNLIQVGGGSNNSGQDSSDDDTSSFYRVFLNYGTISGGI
YKEISEETKEWISANSIESALSIYNQILLEYLNQNDYSKLQLSSVIVGSDKLKKLYQTQS
EDLSQQKPLPPNSLPKSIESLIKMLYDNAIVELASKFGNGNTLSLSPEGTIKTSMGDITL
AQVDKAELALFQLSTLLRTTNTKIDENKSVELFNEVYKALPQIKPSSSKPFDYEHLSDIQ
ESIQVMKDILSVGESLSGLSFSVGNNEAKRYRALHCNITKLDDSSKDYKRLLDQLKLDDK
LSIKSIYKISRNDEENLKFQLGNIKTLYHGSNPSNILGILSRGLLPPNVSTSIGSGRRDI
GYLGSGIYFGTKAMTSAQYCKDSEINHHKYMFICQVALGNCKKYTTHQIQLNQPPKGFNS
VQGVQSTSNLKSEFLDDEIVIYNSKQQKLQYLIEFQDTNLRKELLNIPNQVLNVSNSPQT
TIKPDECPTTIPEKSENKKDIEEEEEQKEIGLVSKSSSGKDDIPLKSVHVRARVLDLIGE
VTIYQHYQNCSSSTIEAKYVFPLDEMGAVCGFEAFINGKHIIGEVKEKEKAHREYREAVA
AGHGAYLMDEDKPDVFTVSVGNLPPKCDVLIKITYVTELSVDGLDISFVLPRSITPRQRL
SSGSNVTQNVTKTVSISDQDQKDSDLTIQVGIDMPYNIVKLTSPTHNIKIKRTHTKATIE
LQPGDKSYLDKNFQLLIGLEEPYSPRMWVEVDDKGHHASMLAFYPKLDIDSTQESFTHLT
LLIDLSASMAGDTFEDLLRAVRLTVRNLRGVPKLLFNICDFGDNYDWLFVEDVLPTEENL
QIAWNHINKLKPISGGTKLHSPLESIYLLSEKAKPTNPHNILLFTDGNVSNEELSLMLAK
KASNFCRLFTFGIGEHCSRHFIKQISRIGSGYADFIVPNKRPNPKKIVDMIQRVLQPAMS
NIEVAFDSTDKIVQSPATISSIFKSERQVIYAFSGICTRATLVCHAPGGGIVSNIVHTPE
IGFIKGNLIHRLAARSMIREYNDGTYSSNKHEHDLIKMKKKQDVIDLSIKYSIVTEFTSF
VAIEKREAGEQIKKIDSIHSIISQTAVDSLPYVAWENKGEGFDQDLNDPSLVSKRDQLIN
LIKEYHSNNRYSDSIRIFYQLNETFGDYSHDELSLLSNTISELISEKVTSLISINISAPT
TPTKPLSSANSKQQRLKKKLKDEIIYEGKGLLRLLESSYNSMSNSSFANQEKLLSLIESQ
YSIYTGLYRCDDNKYSKKQWQEKIENLYNQFINKSKENPLPPTNSTLIKFYHSVSHFYHA
NGDTQKAILISKQAFDNGISELDCLEESSYKDSTLELQKLRDYLNELTVYSDEIVEELEE
ENYTLSDLKEIPSKVSDFENAEKEINTIPQTSAGEWLKAAQVSNITLKQKSFKPKIEIDT
NIRLINDEDPIYKPTSLSYAPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPS
YSPSPLTSITFSPNHPLEPRHIVSLGTKVKESLEPFVYNQVIGAPFLPLPTVYSKKIFPI
SSGPPPPPPPNLYVPQSKRETFISRAVGGAPVPTVIPTPTLPIEALSGFFGGGRGVGSCV
PKAPQKYQQNNNNNNSNYPSPGAPSDHRFNSISGKSSGSMAPRTSLPSAPAPSAPAPPPP
PLPSFGGLAASKSLASDRSDLLSSIRSGVSFKYAGQSSALNANQLEPTQPNSELLNKLSS
ALSLRRMSTCFIDNDEDDEDDWSDSDGGYDGTSISTLTAAAPLQQKKEKKEESHDDIGFG
LFDEYDYYTPQMSNEKLPDKPKIHESEEESDGDMGFGLFGDYNDKPQEKPVSVPINQVSA
PIKPVSVPTKPVRLYQEESDEDMGFDLFGDYDDKPQEKPVSASINQVSAPIKPAVCLYQE
ESDEDMGFDLFGDYDDKPQGKSVSTLTKPASTPINQVSAPTKPVSHKYQEESYEIKEYSR
RRLSRGNQAKSEDTLPAKDEKKKKRKEKKDLKLKERSEIVEEKLKVKPAQSISSFVSPSP
LSSSLSSSSKHSISSLTIKVCTQLRKVVSDLGSSSFKISPTAAALGISEMEFYKYERKLG
GLQSKTFKNLLYLFIFVFLSMLTDETYDIDLITRDIPILACESSLLSYGVDRAYIKNVLK
TSSNKNLLKF
NT seq 7053 nt NT seq  +upstreamnt  +downstreamnt
atgccatcaggatttaataacactcaaaagaagagtaatatactcaatggtaatacattt
tatcttgattgtggtccatcatctgggtataaaattaaaaaagaactacaaacatttatt
gaatcaaatggtggtcttgtttcaatgattttaaaccaaaaggttaattattatgtattc
tatggtgactttcaagatttagtcaaagttgaaaataataatgatgttaatattgaagat
ttatcttttgggattaagaaggcaatcaaactaaatattccaattgtttcaaaaagatat
ttagacgattcagcttcatatggcagtttattatctcatgacgaatattcacttgtatca
aaatacaacattaaagaatatcactataaatcatttgacttttcaaatttattgggggat
aataacaacaatgattcaggtagtgaaaacaaaaataaaaaatttgatagaataaaatat
gatgaaaaatcagatttatttccagaatcaaaatatcatattgtcaaacataatatttta
tccaaacacgataggctttctgataggttttgctgtatcgaactacatgtggcaggtaaa
agtttaaatttaattcaagttggtggtggctcgaataatagtggccaagattcatctgat
gatgatacatcatcattttatagagtttttctcaactatggtacaatttctggtggaatt
tataaagaaattagtgaagaaaccaaagaatggatatcagcaaatagcatcgagagcgct
ttatcaatttataatcaaatattattggagtatctaaatcaaaatgactattcaaaatta
caattaagctctgttatagtaggttcagataaattaaaaaaactttatcaaactcaaagt
gaagatttatcacaacaaaaaccattgccaccaaactcattaccaaagtcaattgaatca
ctaatcaaaatgctctacgataatgccatagtagagttagccagtaaatttggtaatggt
aatacattatcactttcaccagagggtaccattaaaacatcaatgggtgatatcacattg
gctcaagttgataaagctgagttggctttattccaattatccactttacttagaaccaca
aataccaaaattgatgaaaataaatcggtggagctatttaatgaagtttacaaagctttg
ccacaaattaaaccaagctcatccaagccattcgactatgaacatttatctgatattcaa
gagtccatccaagttatgaaggatattttatcagtcggtgaatcattaagtggtttatca
ttttcagttggaaataatgaagctaaaagatatagagcattacattgtaatattaccaag
ctagatgattcaagcaaagattataaaagattattagatcagttaaaattagatgataaa
ttatcaattaaatcaatttataaaataagcagaaatgatgaagagaatttaaagttccaa
ctagggaatattaaaacactatatcatggtagtaatccttcaaatattttaggtatttta
tctaggggtttattaccaccaaatgtttcaacatcaattggttctggaagaagagacatt
ggttatttgggttctggcatttattttggtaccaaagcaatgacaagcgcacaatactgc
aaagattcagaaattaatcatcataaatatatgtttatttgtcaagttgcattgggtaat
tgcaagaaatatacaactcatcaaattcaattaaatcaaccaccaaaaggatttaatagt
gttcagggtgtccaatctacctcaaatttaaaatctgaatttctagatgatgaaattgta
atttataattcaaaacaacaaaaactacaatacttaattgaatttcaagatacaaattta
agaaaagaattattaaatattcccaaccaagtcttaaatgtttcaaatagtccacaaaca
acaattaaaccagatgaatgtcctaccactattccagaaaaatcagaaaataaaaaagat
attgaagaagaagaagagcaaaaagaaattggtctggtttcaaaatcatcatctggcaaa
gatgatattccattaaaatctgttcatgttagagctagagtattagatcttattggagaa
gtcactatctatcaacactatcaaaattgttcctcgtcaactattgaggcaaaatatgtt
tttccattagacgaaatgggtgcagtttgcggttttgaagcatttatcaatggtaaacat
attattggtgaagtaaaagaaaaagaaaaggctcatcgtgaatatcgagaggctgtagct
gcaggccatggtgcttatctaatggacgaagataaacctgatgtgtttacagttagtgtt
ggaaacctaccaccaaagtgtgatgttcttattaaaatcacatatgtcacagagttatca
gttgatggcttggatattagttttgtattaccacgttcaatcacacctagacaacgttta
tcctctggttcaaatgttacacaaaatgttaccaaaactgtttcaatcagtgaccaagac
caaaaagattcagatcttaccatccaagttggtattgatatgccatacaatattgtaaaa
ttaacctcaccaacccataatatcaagatcaaaagaactcacacaaaagctactatcgaa
ctacaaccaggtgataagagctatttagataaaaatttccaactattaattggcctagaa
gaaccctattcaccacgtatgtgggtagaggtagatgataaaggtcatcatgccagtatg
ttggcattctatccaaaattagatatcgatagcactcaagaatcattcactcacttaact
ttactcatcgatttatctgcatctatggctggtgatacatttgaagatcttttaagagca
gttcgtttaactgttaggaatctacgtggtgtaccaaaattacttttcaatatttgtgat
tttggtgacaattatgattggctttttgttgaagatgtcctaccaaccgaagaaaatctc
caaattgcatggaaccacatcaacaaattaaaaccaattagtggtggtacaaaactacac
tctccattggaatcaatttatttgttatcagaaaaagccaaaccaaccaacccacacaat
attctattgtttaccgatggtaatgtttcaaatgaagagttatctttgatgttagcaaaa
aaggcttcaaatttctgtcgtttattcacatttggtattggtgaacattgttccagacat
ttcattaaacaaatttcaagaattggtagtggctatgcagattttattgtccctaataaa
cgtccaaatcctaaaaagattgttgatatgatccaacgtgtactccaacctgcaatgtca
aatatcgaggtagcattcgatagtactgataaaattgttcaatctcctgcaactatttct
tcaatttttaaatcagaaagacaagttatttatgcattctctggtatatgtacacgtgca
acacttgtatgtcatgctccaggtgggggtattgtttcaaacattgttcatacacccgaa
attggatttatcaaaggtaatttgattcatagattggctgcacgttcaatgattagagaa
tataacgatggtacctatagctcaaataagcacgagcatgacttaattaaaatgaaaaag
aaacaagatgttatcgatctttccataaagtatagcattgtaaccgagttcacaagtttt
gtagccattgaaaaaagagaagctggcgaacaaattaaaaaaatcgattcaatccattcg
attatatcccaaactgctgtcgattcattaccatatgttgcatgggaaaacaaaggggaa
ggatttgatcaagacttaaatgacccatcacttgtaagtaaacgtgatcaattaattaat
ttaattaaagagtaccattcaaataatagatactctgactcaattagaatattctatcaa
cttaatgaaacttttggtgactattcacatgatgaactatcattactttcaaatactatt
agtgaattgatttcagaaaaagtaacttcattaatctccatcaatatttctgcaccaaca
acacccaccaaaccattatcatcagcaaattctaaacaacaaagattaaaaaagaaactt
aaagatgaaattatttacgaaggtaaaggattattaaggttattagaaagtagctataat
tcaatgtcgaatagttcctttgccaatcaagagaaattattatctttaatagaatctcaa
tattcaatttatactggtctttatagatgtgacgataacaaatattctaaaaaacaatgg
caagaaaaaattgaaaatctttataatcaatttataaataagtcaaaagaaaacccatta
ccaccaacaaactctactttaatcaagttttatcattcagtttctcacttctaccatgcc
aatggtgatacccaaaaagcaattttaatttcaaaacaagcttttgataatggaatttca
gagctagattgtctcgaggaaagctcatacaaggattcaactttagaactccaaaaacta
agagactatttaaatgaattaaccgtttattcagatgaaattgtcgaagaattagaagaa
gaaaactatactttatcagatcttaaagagatacccagtaaagttagtgatttcgaaaat
gctgaaaaagaaataaatactataccacaaaccagtgccggtgaatggttaaaagctgcc
caagtcagtaatattaccctaaaacaaaaatcatttaaaccaaaaattgaaatcgacaca
aatattagattgataaacgatgaagatcccatttataaaccaacatccctaagctacgct
ccaacatccccaagctactctccaacatccccaagttactctccaacatccccaagttac
tctccaacatccccaagttactctccaacatccccaagctactctccaacatccccaagt
tactctccatctcctctaacatcaatcacattctctccaaatcacccacttgaaccaagg
catattgtatctttgggcacaaaggtcaaagaatcattggagccctttgtatataatcaa
gtaattggtgcaccttttctacccttaccaactgtttacagtaaaaaaatatttccaata
agttctggaccacctccaccaccaccacccaatttgtacgttccccagtcaaaaagggaa
acattcatttcaagagcagtaggcggagcaccagtaccaacagtaattccaacaccaaca
ttacctattgaagcattgtctggattttttggtggaggcagaggcgtcggtagctgtgta
ccaaaagctccacaaaaatatcaacaaaataacaataacaataattccaattacccttca
ccaggagctccttctgatcacagattcaattctattagcggaaagagtagtggctcgatg
gccccaagaacatccttaccatcagccccagccccatcagccccagcccctccacctcca
cctctaccttcatttggtggcttggctgcttctaaatcattagcttccgaccgtagtgat
cttctttcatcgattcgtagtggtgtaagttttaaatatgccggtcaatcttctgcttta
aatgctaatcaattagaacctacccagccaaatagtgaattattaaacaaactttcgtcc
gcactatctttacgtagaatgtcaacttgttttatagataatgatgaagatgatgaagat
gattggtcagattcagatggtggttatgatggaacatcaatatcaacattaacagcagca
gcaccattacaacaaaagaaagaaaagaaagaagaaagccatgatgatataggatttggg
ttgtttgatgaatatgattactatacacctcaaatgtccaacgaaaaattgcctgataaa
ccaaaaattcatgaatctgaagaagaaagtgatggagatatgggttttggtttatttggg
gactataatgacaaaccacaagaaaaaccagtttctgtcccaatcaaccaagtatctgcc
ccaatcaaaccagtttctgtcccaaccaaaccagtacgtttatatcaagaagaaagtgat
gaagatatgggttttgatttatttggagactatgatgataaaccacaagaaaaaccagta
tctgcctcaatcaaccaagtatctgccccaatcaaaccagcagtatgtttatatcaagaa
gaaagtgatgaagatatgggttttgatttatttggagactatgatgataaaccacaagga
aaatcagtatctactctaaccaaaccagcatctactccaatcaaccaggtatctgcccca
accaaaccagtatcccacaaatatcaagaagaaagttatgaaataaaagagtattcaaga
aggagactatctagaggtaatcaagctaaaagtgaagacacactaccagcaaaagatgaa
aagaaaaaaaagagaaaagaaaaaaaggatttaaaattaaaagagagatcagaaattgtg
gaagagaaactaaaagtaaaaccagcacaatccatatcctcctttgtatctccctcacct
ttatcttcatctctctcttcatcctcaaaacattcaatttcaagcctaacaattaaagta
tgtactcaactaagaaaagttgttagtgacttaggttcttcatcattcaaaatttcacca
actgctgctgcattaggcatctctgaaatggaattttataaatacgaaagaaaacttggc
ggtttacaatcaaaaacttttaaaaacttattataccttttcatttttgttttcttaagt
atgcttaccgatgaaacttatgacatcgatcttattaccagagatattccaattttagct
tgtgaatcgagtcttttaagctatggagttgatcgtgcatacatcaaaaatgttttaaaa
acttcatcaaacaaaaatttattaaaattttaa

DBGET integrated database retrieval system