KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_160021Help
Entry
DICPUDRAFT_160021 CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K17890  autophagy-related protein 16-1
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:dpp00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    DICPUDRAFT_160021
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dpp04131]
    DICPUDRAFT_160021
   03029 Mitochondrial biogenesis [BR:dpp03029]
    DICPUDRAFT_160021
Membrane trafficking [BR:dpp04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    DICPUDRAFT_160021
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    DICPUDRAFT_160021
Mitochondrial biogenesis [BR:dpp03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    DICPUDRAFT_160021
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 eIF2A WD40_like KASH_CCD Ge1_WD40 ERM DUF2192 DUF4715 Serglycin
Motif
Other DBs
NCBI-GeneID: 10510734
NCBI-ProteinID: XP_003294930
JGI: Dicpu1_160021
UniProt: F1A5I5
Position
Unknown
AA seq 596 aa AA seqDB search
MYSNNNSNNLSIYSSPIISIASQSFNSIPEWKRDIIRQLNYRNQNQTNCYSDIMKIYSDL
LKRERTLNDRTLLYEKEIVSLRKDANRGGGSGGGSGSSSGTSSTSSNKGSIEEMEQKLYK
LQEDLTNSYKRNAENATSILNLNDKNKDLQNEIMSKEIEVDRAKQVLQQNDDAIKRLEMT
IIEKENVSQILRDELTSLQTEYLHNESKVVKLEQENSSLVERWLRKKNEEASKMNEANDF
YQKMVEQRDLSFVSPAKKSQVPDSYANVVVDISSEEAEKSKIPNIEKGVFTKEALLPSKA
KRRWTAHNSEIYCIAFNTMGNLMASGGGDKAVKVWDIISGQTKATLLGASQSIMSVEFSP
NDETVLGTSNDNSARLWSTELGRSRHTLTGHIGKVYTGKFFNPNRVVTGSHDRTIKLWDL
QKGYCTRTIFCFSSCNDLAILGGTGNHLVSGHVDHSVRFWDSNIGEPTHVLSSIHEGQIT
SITNSPVNSHHILTNSRDHTLKIIDTRTFETIRTFKDQEYRNGLNWTKAAWSPDGAYIAS
GSIDGSICIWDANNGKTIKVLTKVHNNGSSVCCCAWSPLANIFISADKDKNIIQWD
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgtatagtaataacaatagtaataatttatcaatatattcttcgcctataataagtatt
gcatcgcagtcattcaactctataccagaatggaaaagggatataataaggcaattaaat
tatagaaatcaaaatcaaaccaattgctattcagatattatgaaaatatattcagattta
ttaaagagagaaagaacattaaatgacagaactttgctatacgaaaaagagatagtttca
ttaagaaaggatgctaatagaggtggtggaagtggcggtgggagtggtagtagtagtgga
actagctcgacatcatcaaataaaggttcaattgaagaaatggagcaaaaactttataaa
ctacaagaggatttaacaaacagttacaaaagaaatgcagaaaatgctacaagtatttta
aatttaaatgacaaaaataaagatcttcaaaatgaaataatgtcaaaagaaattgaagtg
gatagagctaaacaagttttacagcaaaatgatgatgccattaaaagattagaaatgacc
attatagaaaaagaaaatgtttcacaaattttaagagatgaattaacatcattacagacc
gaatatttacataatgaaagcaaagttgtaaaattagaacaagagaatagtagtttagtt
gaaagatggttaagaaagaaaaatgaagaggcaagtaaaatgaatgaagcaaacgatttt
tatcaaaagatggtagaacagagagatctatcatttgtatctccagcaaaaaaatcacaa
gtaccagatagttatgcaaatgttgttgtagatatatcatcagaagaggcagagaaatcc
aaaataccaaatattgaaaaaggtgttttcactaaagaagccctattaccaagcaaagca
aagagaagatggactgcccacaattcagaaatttattgtattgcattcaatacaatgggt
aatttaatggcaagtggtggcggtgataaagctgttaaagtttgggacattatatctggt
caaaccaaagccacacttttaggtgcatcacaatctataatgtctgtagagttttcgcca
aatgacgaaactgtattgggtacaagtaatgataatagtgcacgcctatggagcactgaa
ctgggtagatcgcgtcatactcttactggtcatattggtaaagtttacactggtaaattc
tttaacccaaatcgtgttgtaactggaagtcacgatcgtaccattaaattgtgggatctt
caaaaaggctattgtacccgtacaatcttttgcttttctagttgtaatgatttagcaatt
ttaggtggaactggaaatcatttggttagtggtcatgtcgaccatagcgtccgtttttgg
gattcaaatattggcgaaccaactcacgtactctcatcaattcacgaaggtcaaatcaca
tcaattacaaactcaccagttaattctcatcatattttaacaaactctcgtgaccatact
ttgaaaattatcgacactcgtacctttgaaaccatcagaaccttcaaggatcaagaatat
cgtaatggccttaattggaccaaagctgcttggtcacctgatggtgcatatatcgcatct
ggttcaattgatggctcaatttgtatctgggatgctaataatggtaaaaccattaaagtt
ttaaccaaagtacataacaatggttcctctgtatgttgttgtgcatggtcaccattagca
aatatatttatttctgctgataaagataaaaatataattcaatgggattaa

DBGET integrated database retrieval system