KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_46840Help
Entry
DICPUDRAFT_46840  CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp00500  Starch and sucrose metabolism
dpp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DICPUDRAFT_46840
Enzymes [BR:dpp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     DICPUDRAFT_46840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_77 CBM_20
Motif
Other DBs
NCBI-GeneID: 10503957
NCBI-ProteinID: XP_003286541
JGI: Dicpu1_46840
UniProt: F0ZGJ9
Position
Unknown
AA seq 909 aa AA seqDB search
MTNLVRFKVNYYTRLGQEVYISGTGEALGNWEEANSKKLHYCDNGDWETLVEFKGDEKEK
NIEYKYFIMDTNGEKIWESGPNRSLNLNDLNSNYIHEFRDTYQSPTSAENTYLDSSFFRE
VLFSRENKQAYSLVKNTSSDKVIIHFQVKSTYVPPTHSIYIVGSNSALGNWRTDRAVKLS
DEFYPVWKVDLEFSKEQLPFSYKYIIADKTKSYVHWEHGSDRWFTASTVHATEYSNTTNE
DRDFFFNDGEFKDSQLLRTAGVAVPVFSLRSKKGLGIGEFNDINALVDWSHQTGLHMIQI
LPINDTTVYYTWRDSYPYSSVSVYALHPIYIHIDSLTKDPKILATVAQHREKLNSLPALD
YEAVMNIKTTLLKEIYAQEKKSLGQNKEFTDFVKENSDWIKAYALYSVLRDTHKSGDFTT
WPVYSTITQEDIEKETSPSSKYYDSVCYYYFVQFHLHLQLLAASKYAVSKRIGLKGDLPI
GVNRVSVDAWVNPHLFRMNMSTGAPPDAFADDGQNWGFPTYNWEVMKKDDYAWWRSRLGQ
MSKYFHAFRIDHILGFFRIWEIPANCVTGLLGKFNPSLPLWRSELANNGVWDLDRLTQPY
IRYHTLREHFGEYADYTASKFLNEYSSNVYQLKPEFSTEKLIEQNLTADDAMYKPGLFKL
VQNVSLCADSEDENRFYPRIEITKTSNFNELSDDMKSTLHRLYISYFFERQEELWAQVAL
QRLPLIKKCTSMLVCGEDLGMVPKCVEPVLHDLGILGLRIQRMPSDSNKDFYHPNEYSYL
TVNTTSSHDMSTLRGWWEEDRARAQVFYNRILGMFGDAPYFCEPYVSEAVIAQHLHSSSM
ISIFPLQDWFGLSTEYGKRDPKEEKINEPSNPMHYWRYRVHVNLEDLIEDTDFSKNIQRL
LLSSNRNLD
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatttagttagatttaaggtcaactattacactcgtttaggtcaagaggtttat
atatctggaacaggtgaagctttaggtaactgggaagaagcaaactcaaaaaaacttcac
tattgcgataatggcgattgggaaactttagttgaatttaagggtgatgaaaaagaaaaa
aatattgaatataaatacttcataatggatactaatggtgaaaaaatttgggaaagtggt
ccaaaccgtagtttaaatttaaatgatttaaattcaaattatattcacgaatttagagat
acttatcaaagcccaacttcagctgaaaatacttatttagattcatcattctttagagaa
gttctttttagcagagaaaataaacaagcttattcattagttaaaaatacttcatcagat
aaggtcattattcattttcaagttaaatcaacctatgtaccaccaactcattcaatttat
attgttggtagtaatagtgctttaggtaattggagaactgatagagcagttaaactttca
gacgaattttacccagtatggaaggttgatttagaattttcaaaagaacaattaccattc
tcttataaatatattattgccgataaaaccaaatcatatgttcactgggaacatggctca
gatagatggttcaccgctagcactgtccacgctactgaatattccaatactaccaatgag
gatcgtgactttttctttaatgatggtgaattcaaagatagtcaattattaagaactgca
ggtgtagctgtaccagtattctcattaagaagtaagaagggtttaggtattggtgaattt
aatgacattaacgctcttgtcgactggtcacaccaaactggcttacatatgattcaaatt
ctcccaattaacgatacaaccgtttactatacctggagagattcttatccatacagttca
gtctctgtttatgcactccatccaatttatattcacattgattcattaaccaaagatcca
aagattttagcaactgttgcccaacatcgtgaaaaattaaactctcttccagctttagat
tacgaagcagttatgaacattaaaaccactcttcttaaagaaatctatgcccaagaaaag
aaatcattaggtcaaaataaagaatttacagattttgttaaagaaaacagcgattggatt
aaagcttacgctctctactctgtcttacgtgacacccacaagagtggtgatttcactaca
tggccagtttattcaacaattactcaagaagatattgaaaaagaaacttcaccatcatca
aaatattatgacagtgtttgttactattactttgtacaattccatttacatcttcaatta
ttagccgcttctaaatacgccgtatcaaagagaattggtttaaagggtgatttgccaatc
ggtgtaaatagagtttcagtcgatgcttgggttaatccacatctctttagaatgaacatg
tcaactggtgcaccaccagatgcttttgctgatgatggtcaaaactggggtttcccaact
tataattgggaggtcatgaagaaagatgactatgcttggtggagatctcgtctaggtcaa
atgtctaaatacttccatgcttttagaattgatcacattcttggtttctttagaatttgg
gaaattccagccaactgtgttactggtttattaggtaaattcaatccatcacttccatta
tggcgttcagagttagcaaataatggtgtttgggatctcgaccgtttaacccaaccatat
attagatatcacactttaagagaacattttggtgaatatgctgactacactgcatctaaa
ttccttaacgaatactcatccaatgtctatcaattaaaaccagagttctccaccgaaaaa
ttaatcgaacaaaatttaacagccgatgatgccatgtacaaaccaggtcttttcaaatta
gtccaaaatgtttcattatgtgctgacagtgaagatgaaaatcgtttctatccaagaatt
gaaatcactaaaactagtaactttaatgaactttcagacgatatgaaatcaactcttcat
cgtttatatatctcttatttcttcgaaagacaagaagaattatgggctcaagttgcactt
caacgtttaccattaattaagaaatgtacatccatgttagtatgtggtgaagatcttggt
atggttccaaaatgtgttgaaccagttctccacgatcttggtattcttggtttaagaatt
caacgtatgccatctgacagtaacaaagatttttatcatccaaacgaatattcctatctt
accgttaatactacctcatcacacgatatgtctactttaagaggttggtgggaagaagac
agagctcgtgcacaagtattctacaacagaattctaggtatgtttggcgatgcaccatat
ttctgtgaaccatatgtttccgaagctgttattgctcaacacttacattcatcaagtatg
atttcaattttcccacttcaagattggtttggtttatcaactgaatatggcaagagagat
ccaaaagaagaaaagatcaacgagccatcaaatccaatgcactattggagatatagagtt
catgtcaatcttgaagatttaatcgaagatacagattttagcaaaaatattcaaagatta
cttttatcatcaaatcgtaatttagattaa

DBGET integrated database retrieval system