KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_48509Help
Entry
DICPUDRAFT_48509  CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp00620  Pyruvate metabolism
dpp00630  Glyoxylate and dicarboxylate metabolism
dpp01100  Metabolic pathways
dpp01110  Biosynthesis of secondary metabolites
dpp01200  Carbon metabolism
Module
dpp_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    DICPUDRAFT_48509
   00630 Glyoxylate and dicarboxylate metabolism
    DICPUDRAFT_48509
Enzymes [BR:dpp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     DICPUDRAFT_48509
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-GeneID: 10502162
NCBI-ProteinID: XP_003289287
JGI: Dicpu1_48509
UniProt: F0ZPD5
Position
Unknown
AA seq 541 aa AA seqDB search
MLKGIEIRANIDQNVQKILNNECLEFLSQLERRFGGIRDNLLQKRKERQDQINGGILPEF
LESTKAVRSGDWKCLPVPQEIQDRRVEITGPTDRKMVINALNSGAKVFMADFEDANCPNW
ENSIYGQINMIDANSRTISYTSPDRREYKLNKDVAILFVRPRGWHLNEEHIYIDGKAMSG
SLFDFGCYIFHNHQILKNRNSSPYFYLPKLESHLEARLWNDVFVFSQEYLKMPIGTIKAT
VLIETILASFEMDEILYELRQHSAGLNCGRWDYIFSFIKKFQNYPNFILPDRSKVTMTSP
FMDTYVKLLIYTCHRRGVHAMGGMAAQIPIKNNKDANDAAMEKVRLDKLREVKAGHDGTW
VAHPALIPIAMEQFNQNMKNANQIDYIPQTPNFSQIQKSLLEVSKIKPGDITEEGFRSNI
VVGIEYLEAWLNGNGCVPIFNLMEDAATAEISRSQIWQWIRHRAPLPNGKPIDINYYNNL
LSEEVSKLEKAHPKSTTLKQAISIFNNLIVSPTFIDFLTPSCYNAIVSSEKVNSPSGSAK
L
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaggaattgaaattagagcaaatattgatcaaaatgttcaaaaaattttaaac
aatgaatgtttagaatttctctcacaattagaaagaagatttggcggtattagagataat
ttattgcaaaaaagaaaagaaagacaagatcaaattaatggtggtattctcccagagttc
ttagaatcaaccaaggcagttcgttcaggtgattggaaatgtttaccagtaccacaagaa
attcaagatcgtcgtgttgaaattactggtccaacagacagaaagatggttatcaatgct
ttaaatagtggtgccaaagtatttatggctgattttgaagatgccaattgcccaaattgg
gaaaattctatctatggccaaattaatatgattgatgcaaatagtagaaccatctcatat
acctcaccagatcgtagagaatacaaacttaataaggatgttgcaattctttttgttaga
ccaagaggatggcacttaaatgaagaacatatttatattgatggtaaagcaatgtctggt
tcacttttcgattttggttgctatattttccataaccatcaaattttaaaaaatagaaac
tcaagtccatacttttatttaccaaaattagaaagtcatttagaagctagattatggaat
gatgtatttgtattttcacaagaatatttaaaaatgccaattggaactattaaagctaca
gttttaattgaaactattttagcctcattcgaaatggatgaaattttatacgaacttaga
caacattcagcaggtttaaattgtggcagatgggattatatttttagctttattaagaaa
ttccaaaactatccaaacttcatattaccagatagatccaaggtcacaatgacaagccca
tttatggacacttacgttaaacttttaatctacacttgtcatagaagaggtgttcacgct
atgggtggtatggctgctcaaattccaattaaaaacaataaagatgcaaatgatgccgct
atggaaaaagttagattagacaaattaagagaggtaaaagcaggtcacgatggcacatgg
gtcgcccatccagctctcatcccaattgcaatggaacaatttaaccaaaacatgaaaaat
gcaaaccaaattgactacatcccacaaacaccaaacttttcccaaattcaaaaatcatta
ttagaagtatcaaaaattaaaccaggagatatcactgaagaaggtttcagaagcaacatt
gttgttggtatcgaatatcttgaagcttggttaaatggtaatggttgtgttccaattttt
aatctcatggaagatgctgccactgctgaaatttccagatcacaaatttggcaatggatt
agacacagagccccactcccaaatggaaaaccaattgacatcaactattataacaatctt
ttaagcgaagaagtttcaaaattagaaaaagctcatccaaaatcaacaacccttaaacaa
gccatttcaattttcaacaatcttattgtttcaccaacatttatcgatttcttaactcca
tcatgttataatgctattgttagttctgaaaaagttaattcaccatcaggttctgcaaaa
ttataa

DBGET integrated database retrieval system