KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_51532Help
Entry
DICPUDRAFT_51532  CDS       T02090                                 

Definition
(RefSeq) myosin heavy chain kinase C
  KO
K08240  myosin-heavy-chain kinase [EC:2.7.11.7]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:dpp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DICPUDRAFT_51532
Enzymes [BR:dpp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.7  myosin-heavy-chain kinase
     DICPUDRAFT_51532
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha_kinase WD40 Nup160 WD40_like ANAPC4_WD40
Motif
Other DBs
NCBI-GeneID: 10506769
NCBI-ProteinID: XP_003294466
JGI: Dicpu1_51532
UniProt: F1A471
Position
Unknown
AA seq 738 aa AA seqDB search
MEEKKTGAAAALALLNQKFPVADVIAGTKCERAIKWELTIGDDLTPKWTHSIVCVSIEKT
PFAKGSCRTAHKLKDWSHPDQGLVGKFSTNKKTTRDSYFTDVLMQTFCAKWAEKFNEAKP
PKPITFLPSYVYELIDHPPPYPVCGGEPFIEGDYKKHNNNSGYVSSDARNTPQSFSHFSY
ELSNHELLIVDIQGVNDFYTDPQIHTKNGEGFGEGNLGETGFHKFLQTHKCNPVCDFLKL
KPINQSKKALLRGTLPVVQLMDFHDAIGLNGNNGSPQKNYDMNYFRNGGGAQQPISLDDE
EKMLQEQLERIRAQQQKNKPAPPLVKQPSGNNLNKQSAAAAAGQPISPKPAIVKTPSQGN
VNKPISPSKETTTTAVVAAATPGGSNVKVESSAPQPQPAHPAPAAVSVQVRNSPPPSQPI
SSGSSSSTTSSTSSVQSGSSPDEQVVPDRSAFEKWDLKTIRNHDTIRGLQSECITGDSSK
LFSGSNDGQIGIWDCSGEIKHITNIKAHGKSVRSIIKRPNFESNILTAGADSYVKEWDIN
TQTVVKEIKESNEVNTIFIQDNLLYTGCNDKTVKVWDMRNYECVKTLSGHTRAIKSVCAL
GNLLFSGSNDQQIYVWNLQTGTILTNFQGHEGWVKTLYTHNNMLYSGSHDETIRVWDLKT
TRCVNTIKCKDRVETLHVTNQGIFAGSGDYLQVFNHEKYENLASVNTRSSILCLWRNQNQ
LFTGSLASNLKVWTWDNM
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaagaaaacaggagcagcagcagctttagcattattaaatcaaaaattccca
gttgctgatgtcattgcaggaaccaagtgcgaaagagcaataaagtgggaattaacaatt
ggtgatgacttaacaccaaaatggacccatagtattgtttgtgtttctatcgaaaaaaca
ccatttgcaaaaggaagttgtagaactgcacataaattaaaagattggagccatccagat
caaggattggtcggcaaattttcaaccaataaaaaaacgacaagagattcatattttaca
gatgttttaatgcaaactttttgtgcaaaatgggctgaaaaattcaatgaagccaaacca
ccaaaaccaattacatttttaccatcttatgtatacgaattaattgatcatccaccacca
tatccagtttgtggtggtgaaccattcattgaaggtgattataagaaacataataacaac
agtggttatgtcagttcagatgcaagaaatacacctcaatcattttcacatttctcatac
gagctttcaaatcacgaacttttaattgttgatattcaaggtgtaaatgatttctataca
gatcctcaaattcatactaaaaatggtgaaggttttggtgagggtaatcttggtgaaaca
ggtttccacaagtttcttcaaacccacaaatgtaatccagtttgtgactttttgaaatta
aaaccaattaatcaatcaaagaaagctcttttaagaggaactttaccagttgtacaatta
atggatttccacgacgcaatcggtttgaatggtaataatggtagtccacaaaagaactat
gatatgaattactttagaaatggtggaggtgctcaacaaccaatttcattagatgacgag
gaaaaaatgcttcaagagcaattagaaagaattagagctcaacaacaaaagaataaacct
gctccaccgttagttaaacaaccatcaggcaacaatttaaataaacaatcagcagcagca
gcagcaggccaaccaatctcaccaaaaccagcaattgttaagacaccttcacaaggcaat
gtaaataaaccaatttcaccatcaaaagaaacaacaactactgcagtagtagcagctgct
acaccaggtggtagtaatgtaaaagtagaaagtagcgctccacaaccacaaccagctcat
ccagctccagcagcagtttcagttcaagttagaaactcaccaccaccatcacaaccaatt
tcatcaggttcatcatcatcaaccacatcatcgacctcatcagttcaatcaggttcatca
ccagacgaacaagtggtaccagatcgttctgcttttgaaaaatgggacttgaaaacaatt
agaaatcatgatactatcagaggtttacaaagtgaatgtatcactggtgattcatcaaaa
ttattcagtggttcaaatgacggtcaaattggtatttgggattgtagtggcgaaattaaa
catattactaacatcaaggctcatggtaagtcagttagatcaatcattaaacgtccaaat
ttcgaatcaaatattttaacagctggtgcagattcatacgtcaaagaatgggatatcaac
actcaaactgttgttaaggaaattaaagagtcaaacgaagtaaacactattttcattcaa
gataatcttttatatactggttgtaacgataaaaccgttaaagtctgggatatgagaaac
tatgagtgtgttaaaactcttagtggccatacccgtgctattaaatctgtatgcgcttta
ggtaaccttttattctctggttcaaatgatcaacaaatctacgtctggaatcttcaaact
ggtactattctcaccaatttccaaggccacgagggttgggttaaaactttatacactcac
aacaatatgctttattctggtagtcacgatgaaactatcagagtttgggatcttaaaact
actcgttgtgttaacaccattaaatgtaaagatcgtgtagagactttacacgtcaccaat
caaggtatttttgctggtagtggtgattatcttcaggttttcaatcacgaaaaatatgaa
aatttagcttctgtaaatacaagatcttcaattctttgtttatggagaaatcaaaatcaa
ttatttactggttcacttgcaagtaatcttaaagtttggacttgggataatatgtaa

DBGET integrated database retrieval system