KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_54584Help
Entry
DICPUDRAFT_54584  CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp00010  Glycolysis / Gluconeogenesis
dpp00562  Inositol phosphate metabolism
dpp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DICPUDRAFT_54584
   00562 Inositol phosphate metabolism
    DICPUDRAFT_54584
Enzymes [BR:dpp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     DICPUDRAFT_54584
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     DICPUDRAFT_54584
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 10500561
NCBI-ProteinID: XP_003286993
JGI: Dicpu1_54584
UniProt: F0ZHT7
Position
Unknown
AA seq 517 aa AA seqDB search
MKINNIIVFKIIFYFIFVPIILSSNSIKTKENINIFNSNNNINNKYINFKQNYDIEFLNK
HLTTKTPYHTNGFYNSNSFINPIPNCKLVSMDIVLRHGSRYPEIKILNKFDSLKKEIQKI
KSLIVGEEFEWLRNYEIPYQRELAGNLIELGNIEHYNISKRLLEKHPNYFETPYSPQSYK
ISSTIIPRTGVSASSFSYGLFEGTGKLPGNFQPVHIQTSNLENDNLLSFFLNCKKYTDKL
KDGSISENEEAIWKQMKYPLIAREISERLGLSGKWLPSNSIVQSIFLSCVYQVAIDNISD
QFCSLLSKENILDWEYAKDLSTYWVNGYGNDINYEISSLLLKDIFNHFDNIINNVQNNST
TPQQQQNKREQQQPQESQEPLPSKDIKDEGPLEEFDKNENSNPKNIFRFGHSETLVPFMS
LLGLFKDGYHIYANSTLEQIKNRKFKTSLIVPYATNIGMFLYDCGNGQNSDFKILVKHNE
SPILVPGCDDYYCSFNDFKSLFPKVLNFDWDSYCNNQ
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataaacaacattatagttttcaaaattatattttactttatttttgtgccaata
atactatcttcaaattctataaaaactaaagaaaatattaatattttcaatagtaataat
aatattaataataaatatataaactttaaacaaaactatgatattgaatttttaaataaa
catttaacaaccaaaacaccataccacacaaatggattttataatagtaactcatttatt
aatccaataccaaattgtaaattagtttcaatggatatagttttaagacatggcagtaga
tacccagaaattaaaattttaaataaatttgatagtttaaaaaaagaaattcaaaagatc
aaatcattaatagttggagaagaatttgaatggttaagaaattacgaaattccatatcaa
agagaattggcagggaatttaattgaattggggaatatagaacactacaatatttcaaag
agactattagagaaacatccaaactattttgaaacaccatatagtcctcaatcttataaa
atatcatccaccattataccaagaactggagttagtgcttcatcattctcatatggcctt
tttgaaggaactggtaaactacccggaaattttcaacctgttcatattcaaacatcaaat
ttagaaaatgataatttattaagcttttttttaaactgtaaaaaatacacggataaatta
aaggatggttcaataagcgaaaatgaggaagcaatttggaaacaaatgaaatatccatta
atcgctagagaaatatcagaacgtttaggtttaagtggtaaatggttaccatccaattca
attgtacaaagtattttcttatcgtgtgtttatcaagtcgcaatcgataatatatcagat
caattttgtagtttattaagtaaagagaatattttagattgggaatatgcaaaagattta
agtacctattgggtcaatggctatggaaatgatataaactatgaaatcagctccctatta
ttaaaagatatattcaatcactttgacaatattataaataatgttcaaaacaattcaaca
acaccacaacaacaacaaaataaacgagaacaacaacaaccacaagaatcacaagaacca
ctaccatcaaaggatatcaaagatgaaggaccattggaagaatttgacaaaaatgaaaat
agtaatccaaaaaatatttttagatttggtcatagcgaaacccttgttccattcatgtca
ctattaggtttatttaaagatggctatcatatttatgcaaattcaactctagaacaaata
aaaaatagaaagtttaaaaccagtttaattgtaccatatgcaacaaatattggaatgttt
ttatatgattgtggaaatggccaaaacagtgattttaaaatattagttaagcataacgaa
tctccaatactagtaccagggtgtgatgattactattgctcgtttaatgattttaaatca
ctctttccaaaagtgttaaattttgactgggattcatattgtaacaaccaataa

DBGET integrated database retrieval system