KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_57810Help
Entry
DICPUDRAFT_57810  CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K00921  1-phosphatidylinositol-3-phosphate 5-kinase [EC:2.7.1.150]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp00562  Inositol phosphate metabolism
dpp01100  Metabolic pathways
dpp04070  Phosphatidylinositol signaling system
dpp04145  Phagosome
Brite
KEGG Orthology (KO) [BR:dpp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    DICPUDRAFT_57810
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    DICPUDRAFT_57810
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    DICPUDRAFT_57810
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dpp04131]
    DICPUDRAFT_57810
Enzymes [BR:dpp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.150  1-phosphatidylinositol-3-phosphate 5-kinase
     DICPUDRAFT_57810
Membrane trafficking [BR:dpp04131]
 Endocytosis
  Macropinocytosis
   Kinases
    DICPUDRAFT_57810
 Endosome - Golgi transport
  Others
   Others
    DICPUDRAFT_57810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PIP5K Cpn60_TCP1
Motif
Other DBs
NCBI-GeneID: 10505995
NCBI-ProteinID: XP_003292247
JGI: Dicpu1_57810
UniProt: F0ZXV4
Position
Unknown
AA seq 1787 aa AA seqDB search
MPQKTSTTSFSMSSLPFFKIPNRNNNNNNNNNNNNINNKGTLAAGSSSISPPNSARSHYN
SGSGSNSHTPQLSSSFSNLPKIESSPPKSDQLNPVVVPTFNHPLKTSLPTFSIQPPSLQP
SPPNNNYAQTIFSPNKNQQQPQQQNNSNNNNNNNINNNNSNNNSNKTIIIAPNSLFFSDP
SIISLKSHPKTTNKVKFLEKYPLPKKYYESSNDLISTFGFKKKNSEAGNLLSLLSTSQQK
EIEEKERSKISNTPQMSFYIQHMGNIVSQELEKNNIDGSWKSIIIGLAKKATDNVKIQVI
NGDKMSTNEYIKIKKIPGGNKLECDYIDGIVMTKILTHKKMKDSFSNPKILLLSCSVEFQ
RVENKFLYFDQLLQQEKDYLRILVSKIAERKPDLVLVEKTVSRHAQDFLLEAGISLALNV
KPKLLERLGRCLGGEVLPTLDIIYPANATPNNGLSPSINPSNSPMMSTPVKSTSLSASTA
LPTTLGSCGQFRVKTFSEVGLKEEGVFGKKTLMYFEKCPTELGSTITIRGENLETLKIIK
KILRFCIYSLHHAYLELKYLLDQSSTPNPLYITNNNGQNLSCSPQIKFPLPKIYPTIPWK
YKFTSQHIPTKKMLLQSFYKPHSDTGQQQSVLQYTSDDEVLGIGTSEAFKQNKMYFPIEN
ESMYDHQSIVYTHSIFCNSTQCIPFELHSINFYTENDLTLGEFLSKFCFSYHVCNIKECN
RPLSEHERTFMNSTTRINVCIQKTQTIPATIQQQQQQQRFPQRSNITVINLCKICNKFSQ
ENKMSEEAWEMSFGKFLELCFFGFLPIKSGDITPECNHNASKDHISYFYYQDFAAIFSYE
PLATLELSLPSKNLKSCHTEKQKLQLRIKQLELMNQCAIQVYDAIQEKLCDLGQDNQDRI
HELIPSLTLERQLICNKIETLIQQAESSTDGNETLINLTKVLYANFMTWNSQLSGLSDST
PYHRSKKNNIQNQTPQTQQLSSSLLSQPQFPSSFVQPPQFASSYSVQPSPLQLQLQQQQQ
QQQQQQKEKEKENNDTEEKEDDESLENKDNEQNTIDSLSETNSISNNNSSNNLHDDNNNN
NNNNNTNNNNNNNQLLSPSIVLNKSSQGINAATLSLPTINNNYNSVETDLTLPLNHQSLN
FAISGFGSYNNIPTVSAIPPSVNGSSNLSMNYSPNGLSKDPAKKQPLKIIDTITNIVTSI
SQTKILGPTMPYLLLESTDNVALFENEPSTTIAYTLSSADFKTALKTLLEEELKKISEIE
KQYEQQEKQEQQEHQPSHPLSQSQSLQNSPVLRPTSLNILDKPILDSLKSLQGENKKQSN
SPISISPLSTSFDKKKVLNSTSPISTILEKEKKHKLNSSSSSISSPSINNNNNEKDEKED
KEEKELKQQNEKQEKDLEFTTATIEELKIQDDTSINEKIEDYKDELIYDDCLDDDVLSDI
YSEKNIRLSKLMVSIQRKEIRSRFKFEKNGYEVNIFCSSYYPVQFHALREYMVGDQDFIQ
SLTRSKIWNAKGGKSGSSWSKTLDDRFILKQVSRIELESFLDFAPLYFEYICKSFLNQIP
TSLCKILGVFTVRWKDSNGKSIKRDLIVMENLFHNKSISKTYDLKGSLRGRLVKNESEVL
LDENLLQASFASPICLGEYDKTRVALAVWNDTAFLSSLNVMDYSLLSGIDTQNNQLVVGI
IDYMRKFTWDKALEMKVKQSGIMGGGGKVPTVISPKQYKIRFRDAMWLYFTLSPDKFTKV
ENLQQIEKKKNNLLNNNNNNNSNNNSNNNNNNRNNSNTNRNNNINSR
NT seq 5364 nt NT seq  +upstreamnt  +downstreamnt
atgccacaaaaaacctctacaacatcattttcaatgtcatcacttccattttttaaaata
ccaaatagaaataataacaacaataacaataataataataataatattaacaacaaaggt
acattggcagctggttcatcatcgatatcaccaccaaattcagcaagaagtcattataac
agtggtagtggatccaatagccatacacctcaactttcatcttcattttcaaatttacca
aaaattgaatcatcaccaccaaaatcagatcaattaaatcctgttgttgtaccaacattt
aatcatcctctaaaaacttctttgccaactttttcaattcaaccaccttcattacaacca
tcaccacctaataacaattatgctcaaacaatattttcaccaaataaaaatcaacaacaa
ccacaacaacaaaataattcaaataacaataataataacaatattaataataataatagt
aataataattcaaataaaacaattattattgcaccaaattctttgttttttagtgatcct
tcaattatatcattaaaaagtcatccaaaaactacaaataaggttaaatttttagaaaaa
tatcctttaccaaagaaatattatgaaagttcaaatgatctaataagtacatttggtttt
aaaaagaaaaatagtgaagcaggtaaccttttatcattattatcaacttctcaacaaaaa
gaaattgaagaaaaggaaagatctaaaatatcaaatactcctcaaatgtctttttatatt
caacacatgggaaatattgtatcgcaagaattagaaaaaaataatattgatggttcatgg
aaatcaataattataggtttggctaaaaaggcaactgataatgtaaaaattcaagtaatt
aacggtgataaaatgtccacaaacgaatatattaaaattaaaaaaattccaggtggtaat
aaattagaatgtgattatatcgatggtattgttatgacaaaaattttaacccataaaaag
atgaaagattcattttcaaatccaaaaatattattattaagttgttcagtagagtttcaa
agagtcgaaaataaattcctttattttgatcaattattacaacaagaaaaagattatctc
cgtattttagtatcaaagattgcagaaagaaaacctgaccttgtattggttgaaaaaaca
gtatcaagacatgctcaagatttcttattggaagccggaatttctttagctttaaatgta
aaaccaaaacttttagaaagattaggtagatgtttaggtggtgaagttttaccaacatta
gatattatatacccggctaatgctacaccaaataatggattatcaccatctatcaatcca
agcaacagtccaatgatgtcaactccagtaaaatcaacaagtttgtcagcatcaacagct
ttaccaactacacttggatcatgtggtcaatttagagttaaaaccttttccgaagttggt
ttaaaagaagaaggtgtttttggtaaaaaaacattaatgtattttgaaaagtgtcctact
gaattgggttcaaccattacaattagaggagaaaatttagaaactttaaagattataaag
aaaattcttagattctgcatttattcattacatcatgcctatttagaattaaaatatctt
ttagatcaatcatcaacaccaaatccactctatattacaaacaataatggtcaaaactta
tcttgttcaccacaaattaaattcccactaccaaaaatttatccaactataccatggaaa
tataaatttacaagtcaacatataccaacaaagaaaatgttacttcaaagtttttataaa
ccacattctgatactggccaacaacaatcagttttacaatatacatcagatgatgaagtt
ttaggtataggtacatcagaagcatttaaacaaaataaaatgtatttcccaatcgaaaat
gaatcaatgtatgaccatcaatctattgtttatacacattcaatcttttgcaattcaacc
caatgtattccattcgaattacattcaatcaacttttatacagagaacgatttaacttta
ggtgaatttcttagtaaattttgttttagttatcatgtatgtaacattaaagaatgtaac
cgtccattatcagaacacgaaagaacttttatgaattccactactcgtataaatgtttgt
attcaaaaaactcagactattccagctacaatccaacagcaacaacaacagcaaagattt
ccacaacgttcaaatatcactgttatcaatctttgtaaaatttgtaataaatttagtcaa
gagaataaaatgtcagaagaagcttgggaaatgtcatttggtaaatttttagaactctgt
ttctttggtttcttaccaatcaaaagtggtgatattacaccagaatgcaatcataatgcc
tccaaagatcatatttcttatttttattatcaagattttgcagcaattttttcttatgaa
ccattggctactcttgaactttccttaccatcaaagaacttaaaatcttgtcacactgaa
aaacaaaagcttcaacttcgtatcaaacaattagaattaatgaatcaatgtgccattcaa
gtatatgatgcaattcaagagaaactttgtgacttgggtcaggataatcaggatagaatt
cacgaattaattccatcattaactttagaaagacaattaatttgtaataaaattgaaact
ttaattcaacaagcagagtcatcaactgatggtaatgaaacgctcattaatcttacaaag
gttttgtatgctaattttatgacatggaattctcaattaagtggtctcagtgatagtacc
ccatatcatcgttcaaagaaaaataatattcaaaaccaaaccccacaaacacaacaatta
tcatcatcacttttatcacaaccacaatttccatcatcatttgtacaaccaccacaattt
gcatcatcatatagtgttcaaccatcaccattacaattacaattacaacaacaacaacag
caacagcaacaacaacaaaaagaaaaagaaaaggaaaataatgatacagaagaaaaagaa
gatgatgaatcattagaaaataaagataatgaacaaaatacaattgattcattaagtgaa
acaaatagtatttcaaataataatagttcaaataatttacatgatgacaataataataat
aataataataataatactaataacaataacaataataatcaattattatcaccatcaatt
gtattaaataaaagtagtcaaggtataaatgctgcaacattatcattaccaacaattaat
aataactataattctgtggaaactgatttaacattaccacttaatcatcaaagtttaaat
tttgcaatttctggctttggttcatataataacatcccaactgtatcagctataccacct
tcagtaaatggttcaagtaatctttcaatgaattattctccaaatggattatcaaaggat
ccagcaaagaaacaaccattaaaaattattgacaccattacaaatattgtaacatctatt
tctcaaactaaaattttaggaccaacaatgccatatcttttattagaaagtacagataat
gttgccttattcgaaaatgaacctagtacaactattgcttatactctatcaagtgctgac
tttaaaactgcattaaaaactttattagaagaagaattgaaaaagattagcgagattgaa
aaacaatatgaacaacaagaaaaacaagaacaacaagaacatcaaccatctcatccatta
tcccaatctcaatcattacaaaactcaccagttttaagacctacaagtttaaatatttta
gataaaccaattcttgatagtttaaagagtttacaaggtgaaaataaaaaacaatcaaat
tccccaatttcaatttcaccattatcaacttcatttgataaaaagaaagttttaaattca
acttcaccaatttcaacaattttagaaaaagaaaaaaaacataaattaaattcatcatca
tcatcaatatcatcaccatcaataaataataataataatgaaaaagatgaaaaggaggat
aaagaggaaaaagaattaaaacaacaaaatgaaaaacaagaaaaagatttagaatttaca
acagcaacaattgaggaattaaaaattcaagatgatacatcaataaatgaaaaaattgaa
gattataaagatgaattaatttatgatgattgtttagatgatgatgtattatcagatatt
tattcagaaaagaatattaggttatcaaaattaatggtatcaattcaacgtaaagaaatt
agaagtagatttaaatttgaaaagaatggttacgaggtaaatattttctgttcatcttat
tatccagtacagtttcatgctttaagagaatatatggttggtgatcaggatttcattcaa
tctttgactagatctaaaatctggaatgcaaaaggtggtaaaagtggttcatcatggagt
aaaacattagatgatcgtttcattcttaaacaagttagtcgtattgaattggaatcattt
ttagatttcgctcctttatatttcgaatatatttgcaaatcattccttaatcaaatccca
acatcactttgcaaaattcttggtgtcttcactgtccgttggaaagattcaaatggtaaa
tcaatcaaaagagatttaatagtcatggaaaaccttttccacaataaatcaatttcaaaa
acttatgatcttaaaggatcactccgtggtagattggtaaagaacgaatccgaagtactc
ttggatgaaaaccttttacaagcttcctttgcatcacccatttgtttaggagaatacgat
aaaactagagttgcattagcagtttggaatgatacagcatttttatcatcattaaatgtt
atggattactctttattatcaggtatagatactcaaaataatcaattggtagttggtatt
atagattatatgagaaagttcacttgggataaagctttagaaatgaaggttaaacaatca
ggtattatgggtggtggtggtaaagttccaactgttatttcaccaaagcaatacaaaatt
agattccgtgatgcaatgtggttatactttactttatcaccagataaattcacaaaagtc
gaaaatttacaacaaatagaaaaaaagaaaaacaatttattaaacaacaataataataat
aatagcaataataatagtaataacaataataataatagaaataatagcaatactaataga
aataataacataaattcaagataa

DBGET integrated database retrieval system