KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_59006Help
Entry
DICPUDRAFT_59006  CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K20029  palmitoyltransferase ZDHHC3/7/25 [EC:2.3.1.225]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:dpp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dpp04131]
    DICPUDRAFT_59006
Enzymes [BR:dpp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     DICPUDRAFT_59006
Membrane trafficking [BR:dpp04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    DICPUDRAFT_59006
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC Wzy_C DUF3675 zf-ribbon_3 zinc_ribbon_2 DUF4834
Motif
Other DBs
NCBI-GeneID: 10506609
NCBI-ProteinID: XP_003294383
JGI: Dicpu1_59006
UniProt: F1A3Y7
Position
Unknown
AA seq 229 aa AA seqDB search
MILAIQVLLNYYLTSTIDPGSFKDTTSPSYYLANPVSQDYEEKFCSKCNEQKPERAHHCR
YCNRCVLRLDHHCQWINNCVGLFNQKYFVLFLFYTSIAIIYFFILLINRTIELISKHSME
QTLPEFDLLHLLLLGFLIIVLIIAAISILALLSTQIYLISKNLTTIEQEDRKRKHLQPNS
SNLYKKYDKGSIISNFTVVFGNPSLYWLLPTPPNLLYKGNNKKGDIFIV
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgattttagcaatacaggttctattaaattattatttaacatcaactatagaccctggt
tcatttaaagatacaacttcaccatcctattatcttgcaaatcctgtatctcaagactat
gaggaaaagttttgtagtaaatgtaatgaacaaaaaccagaaagggcccaccattgtaga
tattgcaatagatgtgttttacgattagatcatcattgtcaatggataaataattgtgtt
ggtcttttcaatcaaaaatattttgtattgtttttattttatacatcaattgctattata
tattttttcattttattaattaatagaaccatagagttaatttcaaaacattcaatggaa
caaacattaccagaatttgatttgttacatttattattgttagggtttttaattattgtt
ttaattattgcagcaatttcaatattggcattattatcaactcaaatttatttaatctct
aaaaacttaacaacaatcgagcaagaagatagaaagagaaaacatttacaaccaaactct
tcaaatttatataaaaaatatgacaaaggttcaattatatcaaatttcacagtggtcttt
ggtaatccatcattgtattggcttttaccaacaccacccaatcttttatataaaggaaat
aataaaaagggtgatatatttatagtgtaa

DBGET integrated database retrieval system