KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_77009Help
Entry
DICPUDRAFT_77009  CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K03145  transcription elongation factor S-II
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:dpp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:dpp03021]
    DICPUDRAFT_77009
Transcription machinery [BR:dpp03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription elongation factors
     DICPUDRAFT_77009
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFIIS_M TFIIS_C Med26
Motif
Other DBs
NCBI-GeneID: 10499993
NCBI-ProteinID: XP_003286096
JGI: Dicpu1_77009
UniProt: F0ZFB7
Position
Unknown
AA seq 310 aa AA seqDB search
MEDIKKLKDNLEKALNQSELDKVLEYLKKANDFEINKEVLKSTDIGKTVGKLRTHKDIGI
SKQSSILIDKWKKDIEKSTPISTPTSTKPASSAASPSSSFKRKSSDTVQTTTTVAKQEIE
ERPSKRVFEEKKISTTTFKCTITPIKTGGDAGQRNKMIQLLAESLTREIDETLSSPEDVA
TEVEAELYSIYKGLTADYKNKVRSFKFNLQSNDGLRDSLLNRILTIEKFCSMDVMSMASD
ELKEERRKLDKFQTEASMIGTNNEATTDQFQCGKCKQRRCTYFQMQTRSADEPMTTFVRC
INCGNRWKFC
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggaagatattaaaaagcttaaagacaatttagaaaaagctttaaatcaatctgaactc
gacaaagtattagaatatttaaaaaaggcaaatgactttgaaattaataaagaggtctta
aagagtacagatattggaaaaacagttggtaaattaagaacacataaagatataggaatt
tcaaaacaaagttctattttaattgataaatggaagaaagatattgaaaaatcaacacca
atatcgacaccaacatcaacaaaacctgcctcatcagcagcctcaccatcctcatcattt
aaaagaaaatcatcagatactgttcaaacaaccacaacagtagcaaaacaagagattgag
gagagaccaagcaaaagagtatttgaagagaaaaaaatttcaaccacaacatttaaatgt
actattaccccaattaaaacaggtggagatgcaggtcaaagaaacaaaatgattcaacta
ttggcagagtctttaacaagggaaatcgacgaaaccctttcatcaccagaggatgttgcg
actgaagtagaagcagagctttacagtatttataaaggtttaacagcagattataaaaac
aaagttagatcttttaaatttaatcttcaatcaaatgatggtttaagagattctttatta
aatagaatattaactatagaaaaattttgttcaatggatgttatgtcaatggccagtgat
gaattaaaagaggaaagaagaaaattagataaattccaaactgaagcttcgatgattggt
actaataatgaagctacaactgatcaattccaatgtggtaaatgcaaacaaagaagatgt
acatacttccaaatgcaaactcgttctgctgatgaacctatgacaacttttgttagatgt
attaattgtggtaatagatggaaattttgttaa

DBGET integrated database retrieval system