KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_78261Help
Entry
DICPUDRAFT_78261  CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:dpp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DICPUDRAFT_78261
Enzymes [BR:dpp01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     DICPUDRAFT_78261
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 EF-hand_1 EF-hand_6 Pyr_redox EF-hand_7 EF-hand_5 EF-hand_8 SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 10501371
NCBI-ProteinID: XP_003287409
JGI: Dicpu1_78261
UniProt: F0ZJ16
Position
Unknown
AA seq 643 aa AA seqDB search
MIKQIINPKNYNQVRLLNNSTTTTKFKNIRFCSTTNTNSNNDINNNGFNSEDQNSNNNND
QNNNNEKKSKFFKYSVLGGLTGLGLVATSSLLLDEKVNDNHVISQLEIPRDPKSKKERVI
ILGTGWSSLAFTQGIDLDKYEIIVISPRNYFLFTPLLTSSAVGSVEVRSIIEPIRRVLFR
LTKAHTTYIEAKCTEIDHENNQIVIKSNDGIVAKLPYDQLVIGVGSEPSSFGTKGVEENT
IFLKHAMDAHKIRQKIMDCFENASIQKMVPGTTEEDLKNLLHFVLVGGGPTAVEASGSLH
DYIKEDLSKMFPHIAQYSKITLIQSADHLLNTYDLKISEYTEGQFQRSGIEVLTNTRAVE
VKKDRIVIMKKAHQRPPGEPLKETENPKKGPEVSVPVEIPFGMCVWSTGVGPNDLVRSFC
NSIETQKNSRAITTDHQLQVIGIKNKNVYAVGDCSTISQSLLMAKINDLFKEADTNGDNK
LSFDEIKVLFSKHSKDYPQLRPYSDGFIEFFNEFDFNKDGFLSLNEFKGLMCKVDSNLTT
LPSTAQCANQMGKYLADSFNEKHGKGKDHTVEPFHYKHLGNFAYIGKSNAIADIPDLIKG
GGIGVYIMWKFVYLEKQFSFRNKFLVFTDWIKTGLFGRDISRI
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaacaaataataaatccaaaaaattataatcaagttagattattaaataattca
acaacaacaacaaaatttaaaaatattagattttgttctactactaataccaatagtaat
aatgatattaataataatggttttaatagtgaggatcaaaatagtaataataacaatgac
caaaataataataatgaaaagaaatcgaaattttttaaatatagtgttttgggcggtctt
accggattgggtttagttgcaaccagttcattattattggatgaaaaagtaaatgataat
catgttatttcacaattagaaatcccaagagatccaaaaagtaaaaaagaaagagttatc
attcttggtactggttggtcttcattagcatttacccaaggtatcgatttagataaatat
gaaattatcgttatttcaccaagaaattactttttatttactccattattaacatcgtct
gcagttggaagtgttgaagttagaagtattattgagccaattagaagagtattgtttaga
ttaaccaaagcacatacaacatatatcgaagctaaatgtacagaaattgatcatgaaaat
aatcaaatagtaattaaatcaaatgacggaatcgttgcaaaattaccatatgatcaattg
gttataggtgtaggaagtgaaccaagtagttttggaaccaaaggtgtcgaagagaatacc
atctttttaaagcatgctatggatgcacataaaataagacaaaagattatggattgtttc
gaaaatgcatccattcaaaaaatggtacctggtaccaccgaagaggacttaaagaacctt
ttacattttgtattggtaggtggtggcccaacagcagtcgaagcaagtggctcattacat
gactatatcaaagaagatttatcaaaaatgttcccacacattgcacaatactctaaaatc
actttaatacaatcagcagaccatttattaaatacttatgatttaaaaatctcagagtac
accgaaggccaattccaaagatctggcattgaagtattaaccaatactcgtgcagtcgag
gttaaaaaagatcgtattgttatcatgaagaaagcccatcaacgtccaccaggcgagcca
ttaaaggaaaccgagaacccaaagaaaggaccagaggtttcagttccggtagaaattcca
tttggtatgtgtgtttggagtacaggtgtcggtccaaatgatttagtacgttcattctgt
aacagtatcgaaacccaaaaaaacagtagagccatcactactgaccatcaattgcaagta
atcggtatcaaaaataagaatgtttatgcagttggtgattgttcaaccatttcacaatca
cttttaatggctaaaatcaatgatctctttaaagaagcagataccaacggtgataacaaa
ttatcatttgatgaaatcaaagtattattctcaaagcactctaaagactacccacaactt
agaccatacagcgatggtttcattgaattctttaacgagtttgatttcaacaaggatggg
tttttaagtttaaacgagtttaagggtttaatgtgcaaagtcgactctaatctaaccaca
cttccatccactgctcagtgtgcaaatcaaatgggcaaatatttggctgattcctttaat
gaaaagcatggaaaaggtaaagatcatactgtagagccattccactataaacatttaggt
aactttgcatatattggtaaaagcaatgctattgctgatattcccgatcttattaaaggt
ggtggcattggtgtctatattatgtggaaattcgtatatcttgaaaaacaattctcattc
cgtaataaatttttagtttttactgattggatcaaaactggtttatttggacgtgatatc
agtagaatttaa

DBGET integrated database retrieval system