KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_85721
Entry
DICPUDRAFT_85721  CDS       T02090                                 

Definition
(RefSeq) p20-arc
  KO
K05755  actin related protein 2/3 complex, subunit 4
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:dpp00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    DICPUDRAFT_85721
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dpp04131]
    DICPUDRAFT_85721
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dpp04812]
    DICPUDRAFT_85721
Membrane trafficking [BR:dpp04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    DICPUDRAFT_85721
Cytoskeleton proteins [BR:dpp04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     DICPUDRAFT_85721
SSDB
Motif
Pfam: ARPC4
Other DBs
NCBI-GeneID: 10503511
NCBI-ProteinID: XP_003283125
JGI: Dicpu1_85721
UniProt: F0Z6V2
Position
Unknown
AA seq 169 aa
MSLAQVPYLNCIRNTLTASMCLQNFGSQIVERHNKPEVEVKTSKELVLNPVIIARNKAER
VLIETSINSIRISVSIKKSDEVDVILAKKFVRFLVQRAESFIILRRKPVEGYDISFLVTN
FHTESMFKHKLVDFIIQFMEDIDKEVSDLKLTLNARGRIIASEYLKNFA
NT seq 510 nt   +upstreamnt  +downstreamnt
atgtcattagctcaagttccatatttaaattgtattagaaatactttaactgcttcaatg
tgtctccaaaactttggttcacaaattgttgaaagacacaacaaaccagaagttgaagtc
aaaacaagcaaagaattagttttaaatccagttattattgctcgtaataaagctgaaaga
gttttaattgaaacctcaattaattctattcgtatcagtgtttcaatcaaaaaatctgat
gaagttgatgttattcttgctaaaaaattcgttcgtttccttgttcaaagagctgaaagt
ttcatcatcttaagaagaaaaccagtcgaaggttacgatattagtttcttagttaccaac
ttccacaccgaaagtatgttcaaacataaactcgttgatttcattattcaatttatggaa
gatatcgataaggaagtcagtgacttaaaattaactcttaatgccagaggtcgtatcatt
gcttctgaatacttaaagaactttgcttaa

DBGET integrated database retrieval system