KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_90799Help
Entry
DICPUDRAFT_90799  CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Brite
Enzymes [BR:dpp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     DICPUDRAFT_90799
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 Methyltransf_11 Methyltransf_12 Methyltransf_18 Methyltransf_23 Methyltransf_32 MTS Ubie_methyltran Methyltr_RsmB-F GidB Methyltransf_24 Methyltransf_3 Fibrillarin
Motif
Other DBs
NCBI-GeneID: 10507233
NCBI-ProteinID: XP_003294697
JGI: Dicpu1_90799
UniProt: F1A4V3
Position
Unknown
AA seq 281 aa AA seqDB search
MKRFIEDNKTSLIVSLGVITVSSLAYLSYKQEFFKRRINPLPQTQNELVDLLHYQKRMVL
NRDIVKTLRYVDRKLFLDEDCKNPYYDEPKPIGYNATISAPHMHAVMLDYLAAYIPKNNG
LALDIGSGSGFVSACLADLMGATGKVVGVEHIPELVDRAKNSINKLDSELLNRIEFKVGD
GIQGYDNGTKYDVIYLGAAIESLGVAATLIDQLKQGGRMIMPVGKSEDFHELMIVDKDID
GMVSVKSCGVVRFVPLVKNKEEQLSIYKSPNQTKSPDYSCS
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagatttatagaagataataaaactagtttaattgtatcactaggtgtaataaca
gtttcatctttagcttatttatcatataaacaagagtttttcaaaagaagaattaatcca
ttgccacaaacacaaaatgaattagtagatttacttcattatcaaaaaagaatggtatta
aatagagatattgttaaaacattaagatatgtcgatagaaaattgtttttggatgaggat
tgtaaaaatccatattatgatgagcccaaaccaataggttataatgctacaatttcagca
ccacatatgcatgctgtaatgttggattatttagctgcttatataccaaagaataatggt
ttggcgctagatatcggtagcggttcagggtttgttagtgcatgtttggcagatttaatg
ggtgcaacaggtaaagtggttggtgttgaacatatcccagaattggttgatagagctaag
aatagtattaataaattagatagtgagctattaaatagaatcgagtttaaagtgggcgat
ggtatccaaggttatgataatggcacaaagtatgatgttatttatttgggtgccgccatc
gaatcattaggggttgcagctacattaatagaccaattaaaacaaggtggtagaatgatc
atgccagtaggtaagtctgaagatttccatgaattaatgattgtagataaagatatagat
ggcatggttagtgtaaaatcatgtggagttgttagatttgtaccattggttaaaaataaa
gaggagcagttatcaatttataaatcaccaaatcaaactaaaagcccagattattcctgc
tcctga

DBGET integrated database retrieval system