KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_91189Help
Entry
DICPUDRAFT_91189  CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp00072  Synthesis and degradation of ketone bodies
dpp00650  Butanoate metabolism
dpp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    DICPUDRAFT_91189
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    DICPUDRAFT_91189
Enzymes [BR:dpp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     DICPUDRAFT_91189
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase 3Beta_HSD DUF1776
Motif
Other DBs
NCBI-GeneID: 10509754
NCBI-ProteinID: XP_003283823
JGI: Dicpu1_91189
UniProt: F0Z8T3
Position
Unknown
AA seq 296 aa AA seqDB search
MFLIKSNKNILNNNLIKPLIRCYSTNTTTNNESLNRMKNKVCFVTGGASGIGLGIVEKFV
KEGGKVAIADLDKGKADVESSRLNKLYPGSTISVGVDVADEQQVQKGIQDTVGSFGGLDV
VVSNAGLQHIESIETLDYSVWRKMMGVHLDGAFLCTKHAMQEFKKDVKRGGTILYMGSVH
SKYASEYKIPYVTAKHGLEGLCRGIAREGAKYNIRANLICPGFVLTPLVQKQIPDLARKF
NMSEESVAKDILLKHTVDGEFTTVEDVAEVAVNFSAIPNKCLTGQSLLVSHGWIME
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgtttttaattaaaagtaataaaaatattttaaataataatttaattaaacctttaatt
agatgttattcaacaaataccaccaccaataatgaatcattaaatagaatgaaaaataaa
gtttgttttgtaactggtggtgcatcaggaattggtttaggtattgttgaaaaatttgta
aaggaaggtggtaaagttgctattgccgatttagataagggcaaagcagatgttgaatca
agtagattaaataaattatatccaggatcaactatttcagtaggtgtcgatgttgcagat
gaacaacaagttcaaaagggtattcaagatactgttggttcatttggtggattagatgtt
gttgtatcaaatgctggtcttcaacatattgaatccattgaaactcttgactattcagtt
tggagaaagatgatgggtgttcatttagatggtgctttcctttgtaccaaacatgccatg
caagaattcaaaaaagatgttaaaagaggtggtaccattctttacatgggtagtgttcac
agtaaatatgcatcagaatataaaattccatatgtaactgctaaacatggtctcgaaggt
ttatgtcgtggtattgctcgtgaaggcgctaaatataatattcgtgcaaatttaatttgc
ccaggttttgttttaaccccattagtccaaaaacaaatcccagatttagcaagaaaattc
aacatgtccgaagaatctgttgccaaagatattttattaaaacacactgttgatggcgaa
tttacaaccgttgaagatgttgccgaagttgctgttaacttttctgctattccaaataaa
tgtttaactggtcaatcattacttgtttcacatggttggattatggaataa

DBGET integrated database retrieval system