KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_93916Help
Entry
DICPUDRAFT_93916  CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp00010  Glycolysis / Gluconeogenesis
dpp00260  Glycine, serine and threonine metabolism
dpp01100  Metabolic pathways
dpp01110  Biosynthesis of secondary metabolites
dpp01130  Biosynthesis of antibiotics
dpp01200  Carbon metabolism
dpp01230  Biosynthesis of amino acids
Module
dpp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dpp_M00002  Glycolysis, core module involving three-carbon compounds
dpp_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DICPUDRAFT_93916
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DICPUDRAFT_93916
Enzymes [BR:dpp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     DICPUDRAFT_93916
Membrane trafficking [BR:dpp04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    DICPUDRAFT_93916
Exosome [BR:dpp04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   DICPUDRAFT_93916
  Exosomal proteins of melanoma cells
   DICPUDRAFT_93916
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 10502754
NCBI-ProteinID: XP_003285412
JGI: Dicpu1_93916
UniProt: F0ZDB2
Position
Unknown
AA seq 249 aa AA seqDB search
MVHKLVLIRHGESTWNKENKFTGWTDVDLSDKGVEEAHDAGKKLKQNGYTFDIAFTSLLK
RAQRTLNIVLEELGESSIPVDKEWRLNERHYGALQGLNKSETATKYGEDQVKIWRRSYSI
PPPPLEESDERFPGNDPLYKDLKKDQLPKTECLEDTVARVLPLWESTIAPTIKSGKKVLI
AAHGNSIRALIKYLDNVSDDGIVSMEIPTGIPLVYELDDELKPIKSYYLADEALLKAAQE
AVANQGKAK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggttcataaattagttttaattagacacggtgaaagtacttggaataaagaaaataaa
tttactggttggactgatgttgacttatcagataaaggtgtagaagaagctcatgatgcc
ggtaagaaattaaagcaaaatggttatacctttgatattgcctttacttcactcttaaag
agagcccaaagaaccctcaacattgttcttgaagaattaggtgaatcaagtattccagta
gacaaagaatggagattaaacgaacgtcactatggtgctcttcaaggtttaaataaatct
gaaactgccactaaatatggtgaagatcaagttaaaatctggagaagatcatactctatt
ccaccaccaccacttgaagaatctgatgaacgtttcccaggtaatgatccactttacaaa
gatttaaaaaaagatcaactcccaaaaactgaatgtcttgaagatactgtcgcaagagtt
ttaccattatgggaatctactattgctccaactatcaagagcggtaaaaaggttttaatt
gctgcccatggtaatagtattagagctttaattaaatatttagataatgtttcagatgat
ggtattgtttcaatggaaattccaactggtatcccattagtctatgaattagatgatgaa
ttaaaaccaatcaaatcatactatcttgctgatgaagctttattgaaagctgctcaagaa
gctgttgccaaccaaggtaaagctaaataa

DBGET integrated database retrieval system