KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_97178Help
Entry
DICPUDRAFT_97178  CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K18081  myotubularin-related protein 1/2 [EC:3.1.3.64 3.1.3.95]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp00562  Inositol phosphate metabolism
dpp01100  Metabolic pathways
dpp04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:dpp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    DICPUDRAFT_97178
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    DICPUDRAFT_97178
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dpp01009]
    DICPUDRAFT_97178
Enzymes [BR:dpp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     DICPUDRAFT_97178
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     DICPUDRAFT_97178
Protein phosphatases and associated proteins [BR:dpp01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    DICPUDRAFT_97178
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related FERM_f0 Y_phosphatase3 DSPc SUIM_assoc
Motif
Other DBs
NCBI-GeneID: 10499364
NCBI-ProteinID: XP_003285796
JGI: Dicpu1_97178
UniProt: F0ZEG8
Position
Unknown
AA seq 1428 aa AA seqDB search
MVRSKDISGDYSNPTPTEIDDQYHYNNNNNNNNNNNNKIGNIGDSYNQSNNSNNNNNNNS
NMNNSNMNNSYINNNNDNSYLDLINLINNKNNNNYETIRLVITIIPWVNEPQEIFIKNLN
MEIGDIVVFSKEKGNDIKIRNLTNYSLYKLITQRKKLLLSNDQTIKTYNLLDGQKLNLIP
INNKENQSQEQLPRWFYKVIVPSNELEGILRDLNSHLDPDREFLDSNKKKKLYDPFHALS
SRNAVNIHDIIQNIKSNKLLTIDSPKRTISNSNNSNHSSYSDPSPIFNQMHHNNNNNSNN
SNISSPKSVSPSSATQWNYTIPSSMESPIHNHNWYQARRVYDVVLKIESEFPYVLDNRTI
DSSVQPEDKWEARVNSSDETFIKTLSMQDSIGSELSKQEYIDFSLRFENRTCLLLGIDYS
FIVWIDPIQTFFTISCSSNTTIRDAVYTILQYLFPSSTNNSSTTKELETFMTMVPYYALY
LQDSSTNKLLALQHKQLLINCNYKPTDSIFVFKKKKNLLSKSSDTPVKNIDLSNHTPPHI
LDEDEGYNLTVLFPTKLTYRQFHFIPTRTVNETIKTILDSVTPHPINPHQQQQQQQQQQY
QPLATTLLVSSLSSTLTTSSTVSSLTSTVEFVSEQTNNLDLNNTLDFENLGFEYIQENNN
PHSYSKSPVSSPPKFYPNSPLNTQKNKPQQKLKLSSTAILNNNTTNTNNNYIFENQNEAQ
KYCLYFQKNGSGVWMEGNRTLISYNLPNETVVEFKPQPTICKISLIEGIQHTIKLYCKSQ
IYTIVYGKFTTIPELEDLISRNIDSLTKRESDSFGLFLIKGEGSQNRRLEICLSSHIGFD
EITFDITSNDYLEFKESHETNIGNAAALAFASMKDPPLIPGEVLIIRKEGQRILQSNQHK
KGIFMLTNFRLIYHATNRSSYVDLTKEDCDIPITTILKVRNGKDNCTIEIQCKNFKVVTL
HCSDPVIWHTLKSQILQNTAITKTFAFKNFEIYDKSIDVIYNIFEEFERLEFPKDKWRIT
HCNFDYSLCPTYPSMFIVPAEVSDEQLKKVAQFREKGRVPAICWIHKNHNSTITRCSQPR
VGLARARSMEDEEYLNIITKSNSNSSTLYVMDSRPMANAKANTLLGKGHENTSLYQNMEL
QFLGIGNIHVMRDSYKKLYLLIQNPESSNWFSQIENTQWLEHIYQLINSSNMVVELVDKN
GSSVLTHCSDGWDRTSQLVALSQLLLDPYYRTIKGFEILIEKEWLSFGHLFTTRSGHIIT
EHGDDDFSPIFLMFIDAVWQLTCLLPTTFQFNEKFLIKILDSVYDCRYKTFLFNNERERL
SYVQKSQSTGGLVSLWSVINSNIEQYVNTFFIPDPKPIYENFFIGDIQFWSNYYMRWNEK
YKSKPQIDLNIIKQIEKILLLQQHQQYQDNDMVNNNKINNNNNEINYE
NT seq 4287 nt NT seq  +upstreamnt  +downstreamnt
atggtgagatctaaagatatctctggtgattatagcaacccaacaccaacagaaatcgac
gatcaatatcattacaataataacaataataataataacaataacaataataaaattggt
aatattggtgatagttataatcaaagcaataatagtaataataataataataataatagt
aatatgaataatagtaatatgaataatagttatattaataataataatgataattcatat
ttagatttaataaatttaataaataataaaaataataataattatgaaactattagatta
gttataaccatcataccatgggtaaacgagccacaggaaatatttattaaaaatcttaat
atggagattggcgatatagttgtattttctaaagaaaaaggaaatgatatcaaaattaga
aatttaacaaattatagtctttataaacttattacacaaagaaagaaattattactatca
aacgatcaaacaattaaaacttataatttattggatggtcaaaagttaaatttaatccca
atcaataataaagaaaatcaatcacaagagcaattaccaagatggttttataaagttatt
gttccatcaaatgagttggaaggaattttaagggatttaaactcgcatttagaccctgac
agagaatttttagattcaaataaaaaaaagaaactctatgatccatttcatgcactatcc
tcaagaaacgctgttaatattcacgatattattcaaaatattaaatcaaataaactatta
accatcgatagtccaaaaagaacaatttcgaatagtaacaacagtaatcatagtagttat
tcagatccatcacctatttttaatcaaatgcatcataataataataataatagtaataat
agtaatatatcatcacccaaatcagtatcaccgtcatcagcaactcaatggaattatact
ataccaagctcaatggagtcaccaatacataatcataattggtatcaagcaagaagagta
tatgatgtggttttaaaaatcgagtccgaatttccatatgttttagataatagaactata
gattcaagtgtgcaacctgaggataaatgggaggctagggttaattcatctgacgaaact
tttattaagaccctctcaatgcaagacagtattggttctgaattatcaaagcaggagtat
atagacttttcattaagatttgaaaacagaacctgtttattattgggtattgattatagc
ttcatagtctggattgatcctattcaaacattctttaccatatcatgtagctccaataca
actataagagatgctgtatatacaattcttcaatatttattcccatcatctacaaacaac
tccagtactaccaaagaattggaaacctttatgactatggttccatattatgctttatat
ttgcaagactcatccacaaataagctattagcattacagcataagcagcttttaatcaat
tgtaattataaaccaacggattcaatatttgtatttaaaaagaaaaagaacctactatca
aaatctagtgacaccccagttaaaaatattgacctttcaaatcatactccaccacatata
ttggacgaagatgaaggctacaatttaacagtacttttcccaaccaaattaacatatcgt
caatttcattttatacccactagaactgtaaatgaaactattaaaacaattttagattct
gtaacaccacacccaatcaatcctcatcaacaacagcaacaacaacagcaacaacaatac
caaccattagcaacaacattattggtatcatcattatcatctaccttaacaacctcatca
actgtgtcatcattaacatcaactgttgaatttgtttcggaacaaaccaataatttagat
cttaacaatactttagattttgaaaacctaggctttgaatatatacaagaaaataataac
ccgcatagctattcaaagtcacctgtatcatcaccaccaaaattctatccaaactctcca
ttaaacacccaaaaaaataaaccacaacaaaaactaaagctatcaagcaccgccatatta
aataataatacaacaaatacaaataataactatatttttgaaaatcaaaatgaagctcaa
aaatattgtttatatttccagaaaaatggttcgggtgtttggatggaaggtaatagaaca
ttaatatcatataatttaccaaacgagactgtcgtcgaatttaaaccacaaccaacaatt
tgtaaaatctcattaattgaaggtattcagcatacaattaaactttattgcaaatcacaa
atttatacaatcgtctatggcaagtttacaactataccagaattagaagatttaattagc
agaaatattgattcattaacaaagagggaatcagattcatttgggttatttttaattaaa
ggagaaggatcacaaaatagacgattggaaatatgtttatcatcacatattggttttgac
gaaattacatttgacataacatccaatgactatttagaatttaaagaatcccacgagacc
aatattggtaatgcagcagcattggcattcgcttcaatgaaagatccacctcttattcct
ggcgaagttttaataattcgaaaggaaggtcaaagaattttacaatctaatcaacataaa
aaaggtatttttatgttaacaaacttccgtttaatttaccacgctacaaatagatcatca
tatgtagacctcacaaaagaagactgtgatattccaattacaacaatcttaaaagttaga
aatggtaaagataactgcactatcgaaattcaatgtaaaaactttaaagtagtgacactc
cattgttcagaccctgttatttggcacacactaaaatctcaaattttacaaaatacagca
attacaaaaacctttgcatttaagaattttgaaatttatgataaatcaattgatgtaatt
tataatatttttgaagaatttgaaagattagaatttcctaaagataaatggagaattaca
cattgcaactttgattatagtctatgtcctacatatccatcaatgtttattgtaccagca
gaggtatcagatgaacaattaaaaaaagtagcacagtttagagaaaaaggaagggtacca
gctatttgttggatacataagaatcataattcaaccattacaagatgtagtcaaccaaga
gttggtttggcgcgtgcaagatcaatggaagatgaagaatacttgaatattattaccaaa
tcaaattcaaactcatccacactatacgttatggactctaggccaatggcaaatgcaaaa
gcaaatacactattaggcaaaggtcatgaaaatacaagtctctatcaaaatatggaactt
caattccttggtattggtaatattcatgtaatgagagatagttataaaaagctctattta
ttaattcaaaatccagaatcgtccaattggttttcgcaaatagaaaatacccaatggttg
gagcatatttaccaattaatcaactcatccaatatggtggtcgagctagtagataaaaat
ggttcatcagtacttactcattgttccgatggttgggatcgtaccagtcaacttgtagct
ttatctcaattattactagatccatactatagaaccattaaaggtttcgaaattcttatc
gaaaaggaatggctatcatttggccatctctttacaacacgtagcggtcatatcattact
gaacatggtgatgatgatttctccccaatctttttaatgtttatcgatgcggtttggcaa
cttacatgtcttttaccaacaacattccaatttaacgagaaattccttatcaagattcta
gactctgtttacgattgccgttataaaacctttttgttcaataatgaaagagaaaggcta
tcgtatgtccaaaaaagtcaatctactggtggtttagtatctctttggagtgttattaat
tccaatatcgaacaatatgtaaacacatttttcatcccagatccaaaaccaatttacgaa
aacttttttattggtgatatacaattttggtcaaattactacatgagatggaacgaaaaa
tataaatcaaaacctcaaatcgatttaaatattataaaacaaatagaaaaaatattatta
ttacaacaacaccaacaatatcaagataatgatatggtcaataataacaaaattaataac
aacaataatgaaattaactatgaataa

DBGET integrated database retrieval system