KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_97663
Entry
DICPUDRAFT_97663  CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K03781  catalase [EC:1.11.1.6]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp00380  Tryptophan metabolism
dpp00630  Glyoxylate and dicarboxylate metabolism
dpp01100  Metabolic pathways
dpp01110  Biosynthesis of secondary metabolites
dpp01200  Carbon metabolism
dpp04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:dpp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    DICPUDRAFT_97663
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    DICPUDRAFT_97663
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    DICPUDRAFT_97663
Enzymes [BR:dpp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     DICPUDRAFT_97663
SSDB
Motif
Pfam: Catalase Catalase-rel Catalase_C DJ-1_PfpI
Other DBs
NCBI-GeneID: 10501164
NCBI-ProteinID: XP_003287292
JGI: Dicpu1_97663
UniProt: F0ZIQ0
Position
Unknown
AA seq 691 aa
MDKKIEQLKCFESSPKGENSTTNFGVKISNDENTLKAGPRGPSLLEDFVFREKMTHFDHE
RIPERIVHARGSGAHGYFVSYADHSNLTKASFLSAKDKKTPLFARVSTVQGPRGSADTVR
DVRGFAVKFYTDEGNFDIVGNNIPVFFVQDAISFPDFVHAGKMEQQNEMPTGGSAHDTFY
DYISLKPETAHTVMWVMSDRGIPLSIRHLQAFGVHTYRLINAQGKSTFIKWFWKPLSGTL
SLLWDEAQKIAGKNGDYHRKRLWDDIEAGDFPQWELCVQILSDEIIEKFEFDILDPTKFI
PEELAPVTPVGRMVLNKNPDNFFAETEQIAFCVSHVVPGIDFSNDPLLQGRIFSYLDTQL
SRLGGPNFNEIPINRPVCPFANTQRDGIHRMTINKGGANYFPNSIDGNYPRPKEEASVKG
GFLPYPEKIDAVKTYKRSETFNDHFSQATMFWNSMSQHEKNHIVDGFSFELSKVTRRNIV
ERVVNEFLINIDKTLAEKVGKNLGVTVEPKVTKNIQKKLVKPSPAISQVNLLSGDIASRR
IAVLIFDGCDTEDVMSFKKEMEKRDAHVDLLAPSNAPVRGCDGPSLTPKSSWVSEPSIFY
DAVYVPSCGQESLELLQHNGDFLHYILESYKHLKTIAFSGCPSIIKETLRLKQDLGLILG
QGWRDVVEAFTYSLAHHRVWERESLASTIPA
NT seq 2076 nt   +upstreamnt  +downstreamnt
atggataagaaaatagaacaattaaaatgttttgaaagtagcccaaaaggtgaaaactca
actacaaattttggagttaaaatctcaaatgatgaaaacaccttaaaagcaggtccaagg
ggtccttcattattagaggattttgtttttagggaaaaaatgacccatttcgatcatgaa
agaatcccagaaagaatagttcacgcaagaggaagtggtgcacatggttattttgtttca
tatgcagatcatagtaatcttacaaaagcaagtttcctttcagcaaaagataagaaaaca
cctcttttcgctcgtgtttcaactgttcaaggtcctagaggttcagctgataccgtacgt
gatgttagaggttttgctgttaaattctatactgacgaaggtaattttgatattgttgga
aacaatattccagttttctttgttcaagatgcaattagtttcccagactttgtacatgct
ggtaaaatggaacaacaaaacgaaatgccaactggtggatcagcccatgatacattttat
gactatataagtttaaaaccagaaactgctcatacagtaatgtgggtaatgtctgatagg
ggtattccattgtcaattcgtcatttacaagcatttggtgttcatacttatagactaatt
aatgctcaaggaaaatcaacatttatcaaatggttttggaaaccattaagtggtactctt
tcattactttgggacgaagcacaaaagatagctggaaaaaacggtgactatcacagaaag
agactttgggatgatatcgaagctggcgattttccacaatgggagctctgtgttcaaatt
ttatctgatgaaattattgaaaagtttgaatttgacattttagacccaacaaaatttatt
ccagaagaacttgcaccagttacaccagtaggtagaatggtattaaataagaatccagat
aatttctttgctgaaactgaacaaattgctttttgtgtttctcatgtagtaccaggtata
gatttcagtaatgatccattactccaaggtcgtattttctcatacttagatacccagcta
agtcgtttaggaggtccaaactttaatgaaatccctatcaatagaccagtttgcccattt
gcaaatacccaaagagatggtattcatagaatgactattaataaaggtggtgctaactat
ttcccaaattcaattgatggcaattacccaagaccaaaagaagaagctagtgtaaaaggt
ggcttccttccatatcctgaaaaaattgatgctgttaaaacctacaagagaagcgaaact
tttaatgaccatttctcacaagcaaccatgttctggaattcaatgagtcaacacgaaaag
aaccatattgttgatggtttctcttttgaactatcaaaagtaaccagaagaaacattgta
gaacgtgttgtcaacgaatttctcatcaatattgataagacccttgcagagaaagttggt
aaaaacttgggtgttacagtagaaccaaaagtaacaaaaaatattcaaaagaaattagta
aaaccatcaccagcaatcagtcaagtaaatctattatctggggatatagcatcacgtaga
attgctgtactcatctttgatggatgtgacacagaagatgttatgtcatttaaaaaagaa
atggaaaaaagagatgctcatgtagatttactagccccatcaaatgcaccagtcagagga
tgtgacggtccatctttaaccccaaagagtagttgggtaagtgaaccaagtattttctat
gatgccgtttatgttccatcttgtggtcaagaatcattagaactccttcaacacaatggt
gatttccttcactacattttagaatcttacaaacatcttaaaacaattgcatttagtggt
tgtccatcaattatcaaagaaactcttcgtttaaaacaagatcttggtttgattttaggt
caaggttggagagatgttgttgaagctttcacctattcattagcacaccatagagtttgg
gaaagagaatcattggccagtaccattccagcttag

DBGET integrated database retrieval system