KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_97816Help
Entry
DICPUDRAFT_97816  CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:dpp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DICPUDRAFT_97816
Enzymes [BR:dpp01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     DICPUDRAFT_97816
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox SoPB_HTH
Motif
Other DBs
NCBI-GeneID: 10500931
NCBI-ProteinID: XP_003287742
JGI: Dicpu1_97816
UniProt: F0ZK06
Position
Unknown
AA seq 453 aa AA seqDB search
MPKVSHLVARFRNNVVDFISKSSIEKAIARRQAKKSIQKKEKLVLLGTGWASYSYLKHLN
TIKYDVTVVSPRNHFLFTPLLTSSAVGTLEFRSIAEPIRNTRDISDFKYIHAEVTNIDPN
KKQLLVKSKLHNETPFVMDFDELVIGVGGINNSFGIPGVEKYANYLKELAHARTIRKKII
DCFENASLPDVSVKERERLLTFVVVGGGPTGVEFTAELNDFFVEDIQRLFPLVNPNEVKV
ILLEASGKILTAFDESLVKKTLKVFRSSGIDVKTHSPVKEVFDEYVLLADGTKIPYGLLV
WSTGIGANPLIKNSPFEKDPHTGRILVDKHLRVKNFNNIYCFGDCSIVEGENYPLTAQVA
SQEGVYLAKEFNNKEREHPRQPQEFKFKFMGLLAYIGNKNSLFQTPLFDLSGFIAFLTWR
SAYLTRLGSWRAKMMVPMDWLRTIVFGRDISNF
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaagtatcacatttagttgctcgttttagaaataatgtcgttgattttatttca
aaatcatcaatagaaaaagctattgcaagaagacaggcaaagaaatcaattcaaaaaaaa
gaaaaattagtattacttggtactggttgggcaagttacagttatttaaagcatttaaat
actattaaatatgacgttactgtagtttcaccaagaaatcactttttatttacaccactt
ttaacatcatctgcagttggcacattggaatttcgtagtattgcagaaccaataagaaat
acaagagatattagtgatttcaaatatattcatgcagaagtaacaaatattgatccaaat
aaaaaacaattattggttaaatcgaaattacacaatgaaactccttttgttatggatttt
gacgaattggttattggcgtaggcggtattaataatagttttggtataccaggcgttgaa
aagtatgcaaattatttaaaggagttagcacatgctcgtactattcgtaaaaagattatt
gattgctttgaaaatgcatcattaccagatgtatcagttaaagaaagagaaagactatta
acatttgtggttgtaggtggtggtccaaccggtgtagagtttactgcagagttaaatgac
ttttttgttgaagatattcaaagacttttcccactagttaacccaaatgaagtaaaggtt
attctattagaagcatctggaaaaattttaacagcattcgatgaatctctagttaaaaaa
acattaaaggtctttagatcgagcggtatcgatgttaaaactcactcaccagtcaaagaa
gtatttgacgaatatgttttactagcagatggcactaaaattccatatggtctattggta
tggtcaacaggtatcggcgcaaacccattgatcaaaaattcaccatttgaaaaggatcct
cacacaggtagaattttagttgataagcatttaagagttaaaaattttaataatatttat
tgttttggtgattgttcaatcgtcgaaggtgagaactatccattaactgctcaagttgca
agtcaagaaggtgtatatcttgcaaaggaatttaacaataaggaaagagaacatccacgt
caaccacaagaattcaaatttaaattcatgggtttattggcttatattggtaataaaaat
agtttgttccaaactccattgtttgatctttctggtttcattgctttcttaacatggaga
tctgcttatttaacaagattgggttcttggagagctaaaatgatggttccaatggattgg
ttaagaaccattgtttttggtagggatatcagcaacttttaa

DBGET integrated database retrieval system