KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_99951Help
Entry
DICPUDRAFT_99951  CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Brite
KEGG Orthology (KO) [BR:dpp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DICPUDRAFT_99951
Enzymes [BR:dpp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     DICPUDRAFT_99951
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC DUF4199 DUF1272
Motif
Other DBs
NCBI-GeneID: 10506635
NCBI-ProteinID: XP_003294408
JGI: Dicpu1_99951
UniProt: F1A414
Position
Unknown
AA seq 312 aa AA seqDB search
MDRLERILSLFIKLIGPTFVVIAIFLISGITFVHFTVLLPLLIKPTSLTPNNHENFSSTS
IDSTNSNNSSFLFSFLYSLFHYSISFFLLFNIFFNYIMAIVTSPGHPPRLADYTPEKIEE
FNQIKTIKRSETKKFCIYCRLPKEERSHHCSICNNCVSKMDHHCPWLNNCVGQNNHRFFM
LFLFYLWVSCIYVCVLSFPHVFGGGYIPFSILMSFVITLTISVALGGLMFWQLYLVLTNQ
TTIEFLHNRAQQRKAKARGETYTNPYDLGFENNFKEFFKINTFSSWLTFFLPTFKINGQG
NSKKYEPLLEIV
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggataggttggaaaggattctttcgttatttattaagttaataggacctacatttgtt
gttatagcgatatttttaatatctggtataacatttgtgcattttacagttttattacct
ttattaatcaaaccaacatcactaacaccaaataaccatgaaaattttagttcaacttca
atagattcaacaaatagtaataatagttcttttctattttcatttttatacagtttattt
cattattcaatatcattctttttattattcaatatatttttcaattatataatggcaata
gttacttcacctggtcatcctccaagattagcagattataccccagaaaaaattgaagag
tttaatcaaattaaaactattaaaagatctgaaactaaaaaattttgtatatattgtaga
ttaccaaaagaagaaagaagtcatcattgttcaatttgtaataattgtgtttcaaaaatg
gatcaccattgcccatggctaaataactgtgttggtcaaaataatcataggttttttatg
ttgtttttattttatttatgggtttcatgcatttatgtatgtgttttatcatttccacat
gtatttggaggtgggtacataccattttcaattttaatgtcatttgtaataactttgaca
attagtgtggctctaggtggtttaatgttttggcaactttatttagttttaacaaatcaa
actacaattgaatttttacataacagagctcaacaaaggaaagcaaaagcaagaggtgaa
acctatacaaacccttatgatttaggcttcgaaaataactttaaagagttttttaaaatc
aatacatttagcagttggcttacatttttcttacctactttcaaaataaatggccaagga
aacagtaaaaaatacgaaccattattagaaattgtttaa

DBGET integrated database retrieval system