KEGG   Desulfobulbus propionicus: Despr_0645Help
Entry
Despr_0645        CDS       T01413                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
dpr  Desulfobulbus propionicus
Brite
Enzymes [BR:dpr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Despr_0645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 NodS Methyltransf_25 Methyltransf_23 Methyltransf_11 GCD14 RrnaAD DUF938 Methyltransf_32 DsrH
Motif
Other DBs
NCBI-ProteinID: ADW16821
UniProt: E8RCN3
Position
695114..695767
Genome map
AA seq 217 aa AA seqDB search
MSPPSTFDINRERMIEEQLVARGITDQRVLEAMRTVPRHLFVEDAIRAQAYGDFPLPIGS
GQTISQPYVVALMTLALRLTGSEKVLEIGTGSGYHAAVLSRLCQRVYTVERIDGLVSRAR
KVFDRLRYHNIVSRIDDGTVGWPSEAPFDAIVVTAGGPRVPEPLIAQLADPGRLIMPVGG
QDVQELQLVEKHEGSVRVTTIEQVRFVDLIGAYGWPN
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
gtgagcccaccctcgacctttgacatcaatcgcgagcggatgatcgaggagcagctggtt
gcccgggggatcaccgatcagcgggtgctggaggccatgcgcaccgtgcctcggcatctg
ttcgtcgaggacgccatccgggcccaggcctacggggatttccccctgcccatcggcagc
ggccaaaccatctcccagccctacgtggtcgccctcatgaccctggccctgcgcctgacc
ggctcggaaaaggtgctggagatcggcaccggttccggctaccacgcggccgtcctctcc
cgcctctgtcagcgggtgtacacggtggagcggatcgacggcctggtcagccgggcgcgc
aaggtgtttgaccggctccgctaccacaacatcgtctcgcgcatcgacgacggcaccgtg
ggctggccttccgaagcccccttcgacgcgatcgtcgtcaccgccggcggtcctcgggtt
cccgagcctctgatcgcccagctggccgatccgggccggctgatcatgccggttggcggc
caggacgtgcaggaactgcaattggtggagaaacacgagggcagtgtcagggtgaccacc
attgaacaggtgcgtttcgtcgacctgatcggcgcctacggctggcccaactaa

DBGET integrated database retrieval system