KEGG   Desulfobulbus propionicus: Despr_1243Help
Entry
Despr_1243        CDS       T01413                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
dpr  Desulfobulbus propionicus
Pathway
dpr00071  Fatty acid degradation
dpr00072  Synthesis and degradation of ketone bodies
dpr00280  Valine, leucine and isoleucine degradation
dpr00310  Lysine degradation
dpr00362  Benzoate degradation
dpr00380  Tryptophan metabolism
dpr00620  Pyruvate metabolism
dpr00630  Glyoxylate and dicarboxylate metabolism
dpr00640  Propanoate metabolism
dpr00650  Butanoate metabolism
dpr00900  Terpenoid backbone biosynthesis
dpr01100  Metabolic pathways
dpr01110  Biosynthesis of secondary metabolites
dpr01120  Microbial metabolism in diverse environments
dpr01130  Biosynthesis of antibiotics
dpr01200  Carbon metabolism
dpr01212  Fatty acid metabolism
dpr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dpr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Despr_1243
   00630 Glyoxylate and dicarboxylate metabolism
    Despr_1243
   00640 Propanoate metabolism
    Despr_1243
   00650 Butanoate metabolism
    Despr_1243
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Despr_1243
   00072 Synthesis and degradation of ketone bodies
    Despr_1243
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Despr_1243
   00310 Lysine degradation
    Despr_1243
   00380 Tryptophan metabolism
    Despr_1243
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Despr_1243
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Despr_1243
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Despr_1243
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dpr04147]
    Despr_1243
Enzymes [BR:dpr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Despr_1243
Exosome [BR:dpr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Despr_1243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ADW17407
UniProt: E8RI60
Position
complement(1413019..1414203)
Genome map
AA seq 394 aa AA seqDB search
MREVVLVGACRTAVGKFGGSIKDVPAVELGALVIKDALNRSGIKPEMVDEVILGCVLTGA
LGQNPARQAMLKAGIPQDVPAVTINKVCGSGLKSIVMAAQAIQCGDADIIVAGGMENMSA
TAYALPQARFGYRMNAPTNGIIDMMVHDGLHCAMSNCHMGITAENICENWNLSREELDRF
AVESQKKAEAAITSGRFKDEIVPVLIPRRKGAPLVFDTDEHYTPDSTLEKVNKLRPAFKP
DGMVTAANASGINDGAAVIIVMAADKAKELGIKPMAKLTGYASAGVKPEIMGIGPAAASP
KALAKAGKTLTEIDLIEANEAFASQSVAVAKDLGFDMSKVNVNGGAIALGHPIGASGARI
LVSLLHEMEKRGAKSGLATLCIGGGMGIAVVVEK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaagtcgtcctagtcggtgcgtgtcgaactgctgtcggtaaatttggtggttcc
ataaaagacgtcccagcagtggaactgggagctcttgtcatcaaagacgccctgaacagg
tccggcattaagccggaaatggtcgatgaggtaatcttgggatgtgtgctcacaggggcg
ctggggcagaatccggcccgtcaggccatgctcaaagcaggcattccccaagatgttccc
gccgtaactataaacaaggtttgcggtagcggtctcaaatccatcgtgatggccgcccag
gcaattcagtgtggtgacgccgatatcattgtggccggcggcatggaaaacatgagcgcc
acggcttatgctctgccgcaggcacgtttcggttacagaatgaacgcgccgacgaatggt
atcatcgacatgatggtccatgatggcctgcactgcgcgatgagcaattgtcacatgggg
ataacggctgagaacatatgcgagaactggaatctatccagggaggaacttgatcgcttc
gcagtcgaatcacagaaaaaggctgaagcggctattaccagtggacgtttcaaggatgaa
atcgttccggtgctcattccgagacgaaaaggcgctcccctcgtgtttgacactgatgaa
cattacacccctgactccactctggagaaagtcaacaaactgaggcccgcattcaaaccc
gatggcatggtgacagcggccaatgcttcaggcatcaacgatggtgctgcggtcatcatc
gtcatggcggccgataaggcaaaagaattggggatcaagccaatggcaaagttgacgggc
tatgcctccgcaggagtaaagccggaaatcatgggcatcggcccggcagcggcttctcca
aaagcattggcaaaggccggaaagacacttaccgagatagatctgattgaggcaaatgag
gcatttgcctcgcaaagtgttgctgtcgcaaaagatctgggttttgacatgagtaaggtc
aatgtcaacgggggcgcaatagctctcggccacccaataggtgcctctggtgctcgcatt
ctggtgtccttgctccatgaaatggaaaaacggggagcaaaaagcggtctggccacactg
tgcatcggcgggggcatgggaatagcagtggttgtcgagaaatag

DBGET integrated database retrieval system