KEGG   Desulfobulbus propionicus: Despr_1395Help
Entry
Despr_1395        CDS       T01413                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
dpr  Desulfobulbus propionicus
Pathway
dpr00030  Pentose phosphate pathway
dpr01100  Metabolic pathways
dpr01120  Microbial metabolism in diverse environments
dpr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dpr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Despr_1395
Enzymes [BR:dpr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Despr_1395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_N AFOR_C
Motif
Other DBs
NCBI-ProteinID: ADW17558
UniProt: E8RJD3
Position
complement(1585705..1587444)
Genome map
AA seq 579 aa AA seqDB search
MNTDCFHVLLFDLTTGRGQRIQVEGRDQAVGGSGLAALLFSRYGQPDAAWDSPGQPLIFA
IGPLSGYFPLMSKTICAFKSPYHNQYTESHGGGRSAMALRLTGLEALVLIGRSPGPCFLE
VSSTHVHVRECGFLWGQDVHETGKILRRMSKGSGHRSILRIGPAGEHGAAIAGINIDTYR
HFGRLGGGAAMGVKNLKAIILHGDAILPLPEDSRYSKLFGEVHRKVTDSGMMKKYHDLGT
PANLKTLNDLQALPWRNLQATADEAVNRISGERFADEALLRNSACSGCPVGCIHVGFVRE
KFMDSHRYLYRQVGYDYETIFSLGTMLGVADRSGILTLLDLFEKAGMDAMSAGVALAWAT
EATEKGLLSAQETLVPLTFGDVARYQQAAHFFGNGVNAFYRLLGQGTLKATEVYGGQDFA
CVLGQEMAGYATGEVFFAAQALGFRHSHLDSGGYSYDQQHARQDVHAAVDFLVRDEASRA
FLTSTVACLFARNVYTDALLADCLQSLGYEKLAATIPECGRNIQKIRWQTRFACGFRPES
ITIPQRFRELTTWKGPVDPQYLHSLQTEYSRAIVALASA
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgaacacggattgtttccatgtcttgctcttcgacctaacgaccggaagaggacaacgt
attcaagtggaaggccgcgatcaagccgtcggcggcagcggtctggccgccctgcttttt
tctcgatacgggcagcctgatgcagcctgggattctcctgggcagccgctcatttttgcc
atcggcccgctctctggttattttcctttgatgagcaagacgatttgcgccttcaagtct
ccctaccacaatcaatacaccgaaagccacggcggcggccgcagtgccatggcgcttcgt
ctgactggccttgaggccttggtccttattggccgatcgccaggtccgtgttttctggaa
gtgagcagcacccatgtccacgtcagggagtgcggtttcctctgggggcaggacgtacac
gaaacaggcaaaatcctgcggcgcatgagcaaaggttccgggcaccgctccatcctccgc
atcggcccggcgggagaacacggtgcggccattgcgggcatcaatattgacacctatcgc
cattttggacgattgggcggtggcgcggcaatgggggtgaaaaacctcaaggccattatc
ctccacggcgatgccatcttgccgttgcctgaagatagccgctattccaaactgtttgga
gaagtgcaccgcaaagtgacagatagcgggatgatgaaaaaataccacgacctcggcacc
ccggcgaatctcaagacactcaacgacctacaagccctgccctggcgcaacctgcaggca
acggccgacgaagcagtgaaccgcatctccggcgaacggttcgccgatgaggccctgttg
cgcaactcagcctgctcggggtgccctgtggggtgtatccatgttgggtttgtccgggaa
aaattcatggacagccacagatacctgtaccggcaggttggctatgactatgaaacaatc
ttttcactgggcaccatgttgggcgtggcagacaggtccggaatactcacgctccttgac
ctattcgaaaaggctggaatggacgccatgtcagccggggttgcccttgcctgggcgact
gaggccacggaaaagggtttattatccgctcaagagacattggtgccgttgactttcggt
gatgtcgcacgctatcagcaggcagcccatttttttggcaatggagtcaatgccttctac
cggcttctcggccaaggcaccctcaaggcaaccgaagtgtatggcgggcaggattttgcc
tgcgtgctcggccaggaaatggcaggctatgccaccggcgaggtattttttgccgcacag
gcgcttggattccgccattcccatctggacagcggcgggtattcgtacgaccaacagcac
gcccgccaggatgtccacgccgccgtcgactttcttgtccgagacgaggcatcacgtgcc
ttcctgacctccacagtggcctgtctgtttgcccgcaatgtctataccgatgccctcctg
gcagattgcttgcaatcgctcgggtatgaaaaactggccgccaccatccccgaatgcggc
cggaacattcaaaagattcgctggcaaacccgttttgcctgcggcttccgtccagaatcg
ataaccatccctcagcggttccgtgaactcaccacctggaaaggtcctgttgatccgcag
tatctccactccctgcaaaccgagtacagccgggcgattgtagcgcttgccagtgcatga

DBGET integrated database retrieval system