KEGG   Desulfobulbus propionicus: Despr_1405Help
Entry
Despr_1405        CDS       T01413                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
dpr  Desulfobulbus propionicus
Pathway
dpr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dpr01100  Metabolic pathways
dpr01110  Biosynthesis of secondary metabolites
dpr01130  Biosynthesis of antibiotics
dpr01230  Biosynthesis of amino acids
Module
dpr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dpr00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Despr_1405
Enzymes [BR:dpr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Despr_1405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth
Motif
Other DBs
NCBI-ProteinID: ADW17567
UniProt: E8RJE2
Position
complement(1594085..1594849)
Genome map
AA seq 254 aa AA seqDB search
MILDTIVARKQEEVAALKRRGLPQRNQSVEPPRGFIRALVDAPGVAIIAEAKKASPSKGV
IQPDFDPVRIARAYQTGGAHCLSVLTDVDFFQGSLDYIPLVRSAVSLPVLRKDFLIDPLQ
IEEAHAVGADAILLIAAILDPAQLRDYRLLAESLGMDALIEVHDEYELDMALAAESRLIG
INNRNLNDFTVSLETTFRLLRNIPQGTPVVSESGITTVADMQRLKEAGVKAALIGESLMR
AGKQDQLLREFLAA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgattctcgataccattgtcgctcgaaaacaggaagaagtggccgcattgaagcggcgt
ggcctgccgcaaagaaatcaatcggtggaaccaccgcgcggtttcatccgtgccttggtc
gacgcgccaggggtggcgatcattgccgaagccaaaaaggcttccccctccaaaggtgtc
atccagcccgatttcgatccggtgcggatcgcccgcgcctaccagacgggcggcgcccat
tgcctgtccgttctcacggatgtcgatttttttcagggctcgctcgactacattcccttg
gtgcgttcggcggtcagcctgccggtgctgcgcaaggactttcttatcgacccgttgcaa
atcgaggaggcccacgcggtcggcgccgatgccatcctgctcattgccgccatcctcgat
cccgcccagttgcgggattaccggctcctggctgaatccctgggcatggatgcgctgatc
gaggtgcatgacgagtacgaactggacatggccttggctgccgagagccggttgatcggt
atcaacaaccgcaatctcaacgacttcactgtcagcctggaaaccacctttcgcctgttg
cgaaacattccccagggcacgccggtggtcagcgaatcaggcatcaccacggttgcggat
atgcagcggttgaaggaggccggcgtcaaggcggccctgatcggcgagagcctgatgcgg
gccggcaagcaagatcagcttttacgggaatttctcgccgcatga

DBGET integrated database retrieval system