KEGG   Desulfobulbus propionicus: Despr_2594Help
Entry
Despr_2594        CDS       T01413                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
dpr  Desulfobulbus propionicus
Pathway
dpr00010  Glycolysis / Gluconeogenesis
dpr00030  Pentose phosphate pathway
dpr00051  Fructose and mannose metabolism
dpr00052  Galactose metabolism
dpr00680  Methane metabolism
dpr01100  Metabolic pathways
dpr01110  Biosynthesis of secondary metabolites
dpr01120  Microbial metabolism in diverse environments
dpr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dpr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Despr_2594
   00030 Pentose phosphate pathway
    Despr_2594
   00051 Fructose and mannose metabolism
    Despr_2594
   00052 Galactose metabolism
    Despr_2594
  Energy metabolism
   00680 Methane metabolism
    Despr_2594
Enzymes [BR:dpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Despr_2594
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Despr_2594
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ADW18730
UniProt: E8RB65
Position
complement(2976196..2977284)
Genome map
AA seq 362 aa AA seqDB search
MREKLLISTGGGDAPGLNAVIFAVVNSATRKGWEVYGSRYGYGGLLDRDDLVRLTPEDVE
GILSQGGTILGSTNKGNPFCKPVENLAGETQIVDISDKILNAFNRMGFFCHIAVGGDGSL
EIAHRFALKGMPVIGVPKTIDNDLEATDRTFGFDTAVSTATDAIDKLHSTAKSHDRVMVV
EVMGRDSGWIALYSGISGGADVILIPEIPFKLDAVCAKIADNELHGKHYSIVVVAEGARA
EDGEVISKGQGEVGRSEVVLGGIGEWVANQIRQRLGKDTRSLVLGHLQRGGSPTTFDRLL
ALRFGAAAVRMAEAGIFDHMVAWVPPTMTSVPIAEAIRRRKKVDLESDKVRTARDIGICL
GD
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaaaagctactcatatccaccggcggcggcgatgccccgggactgaatgccgtt
atttttgccgtggtcaattccgccaccagaaaggggtgggaggtctacggcagccgatac
gggtacggtggcctgctggatcgagacgacctggtccgcctgaccccagaggacgtcgag
ggcattctttcccagggtgggaccattcttggttccaccaacaagggcaatcccttttgc
aagccggtggaaaatttggctggagagacgcagatcgtcgatatttctgataaaattctc
aatgcgttcaatcggatgggctttttttgccatattgccgtgggcggcgacggcagtttg
gagattgctcaccgttttgccctcaaaggcatgccggtgatcggcgtgcccaagaccatc
gacaatgacctggaggccacggaccggacctttggctttgacaccgccgtgtccaccgcc
accgacgccatcgacaaactgcattccacggccaagtcccacgaccgggtgatggtggtc
gaggtcatgggccgcgattctggctggattgccttgtactccgggatctccggcggcgcc
gatgtgatcctcattccggagattcctttcaagctcgatgcggtctgcgccaagattgcc
gacaacgagttgcacggcaagcactattcgatcgtggtggtggccgagggcgcgcgggcc
gaggatggcgaggtgatcagtaaagggcagggcgaagtcgggcgatccgaggtggtgctc
ggcggtatcggcgaatgggtggccaaccagatccgccagcgtctgggcaaggatacccgg
tccctggtgttggggcatctgcaacgcggcggttcgcccaccacctttgaccggctgctg
gccctgcgcttcggtgcggcggcggtgcgcatggccgaggccggcatcttcgaccacatg
gtggcctgggtaccgccgaccatgacctccgtacccatcgccgaggcgattcggcggcga
aaaaaggtggacctggaaagcgacaaggtacggaccgcccgcgacatcggcatctgtctg
ggtgactga

DBGET integrated database retrieval system