KEGG   Desulfobulbus propionicus: Despr_3129Help
Entry
Despr_3129        CDS       T01413                                 

Definition
(GenBank) ADP-glyceromanno-heptose 6-epimerase precursor
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
dpr  Desulfobulbus propionicus
Pathway
dpr00540  Lipopolysaccharide biosynthesis
dpr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    Despr_3129
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:dpr01005]
    Despr_3129
Enzymes [BR:dpr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     Despr_3129
Lipopolysaccharide biosynthesis proteins [BR:dpr01005]
 Unusual sugar
  Despr_3129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 KR
Motif
Other DBs
NCBI-ProteinID: ADW19261
UniProt: E8RFF4
Position
3604534..3605517
Genome map
AA seq 327 aa AA seqDB search
MIIVTGGLGFIGSNIIHALNARGVTDIIVVDDFTDGTKFTNVSDAQVADYFDKDEFLTRV
QQGQCFNGKVDALLHQGACSATTEWNGKLVMENNFTYSKELFHYADQHRIPFIYASSASV
YGNGTTFIEDPRFERPINVYAYSKTLFDQYVRRHVVSGQSQVVGLRYFNVYGPREQHKGG
MASVAFHLRNQLLSKKVVHLFEGSDGYGPGEQRRDFIHVEDAVDVILWFLEYPAISGIFN
VGTGKSQSFNEVAQAVLTAFGYGELQYIPFPEHLKGRYQSFTEADITRLREAGYNRAFRS
VESGVLDYMEWLGQGEPIFARGAVATL
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgatcattgtcaccggaggattaggttttatcggcagcaacatcatccacgccttgaac
gcccgtggcgtaaccgacatcattgttgttgacgatttcacggacggcaccaaatttacc
aacgtctctgatgcccaggtggctgattatttcgacaaagacgagttcttgacccgtgtg
cagcaagggcagtgcttcaacggaaaggtggatgcgctgctccaccagggagcctgttcc
gccactacggagtggaacggcaagctggtgatggaaaacaacttcacctattccaaggaa
ctgtttcactacgctgaccaacaccgcatacctttcatatatgcctcaagtgcttcggtg
tatggtaatggtacgaccttcatcgaagatccacgattcgaacgaccgattaacgtctat
gcgtactccaagactttgtttgatcagtatgttcgccgtcatgttgtttctggtcaaagc
caggttgtcggtctccggtattttaatgtgtacgggccacgcgaacagcataagggaggc
atggccagcgtggcatttcacctgcgcaatcaactgctttcgaaaaaggttgttcacctt
tttgaaggatcggatggttacggccccggtgaacagcgccgcgattttatccatgtggag
gatgcagttgatgtcatcctctggtttttggagtatccggcaatatccggcattttcaat
gtcggcaccggaaaaagtcagagtttcaacgaggtggcccaggcagtactaacggctttt
gggtacggtgagttgcaatatattcctttcccggaacacctcaaaggtcgttaccagagt
tttaccgaggccgatatcacccgcctgcgagaagcaggatataatcgggcatttcgttcc
gtagaatcgggggttctcgactatatggaatggctgggacaaggcgagcctatcttcgcc
cggggggcggttgccacgctatga

DBGET integrated database retrieval system