KEGG   Desulfotalea psychrophila: DP0100Help
Entry
DP0100            CDS       T00192                                 

Definition
(GenBank) probable triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dps  Desulfotalea psychrophila
Pathway
dps00010  Glycolysis / Gluconeogenesis
dps00051  Fructose and mannose metabolism
dps00562  Inositol phosphate metabolism
dps01100  Metabolic pathways
dps01110  Biosynthesis of secondary metabolites
dps01120  Microbial metabolism in diverse environments
dps01130  Biosynthesis of antibiotics
dps01200  Carbon metabolism
dps01230  Biosynthesis of amino acids
Module
dps_M00002  Glycolysis, core module involving three-carbon compounds
dps_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DP0100
   00051 Fructose and mannose metabolism
    DP0100
   00562 Inositol phosphate metabolism
    DP0100
Enzymes [BR:dps01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     DP0100
Exosome [BR:dps04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   DP0100
  Exosomal proteins of bladder cancer cells
   DP0100
  Exosomal proteins of melanoma cells
   DP0100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Flavi_DEAD
Motif
Other DBs
NCBI-ProteinID: CAG34829
UniProt: Q6AS46
Position
complement(109899..110654)
Genome map
AA seq 251 aa AA seqDB search
MKRKALIAGNWKMHMTVLEGCRLAAEIVASCKDYTDREVLLAPPCTIISEVSHILAGSKI
ILSSHNVCWEEKGAFTGEISPTMLQDAGASCAIVGHSERRQVFFESDEVINKRLKGALAF
GLMGILCIGETLEEREAGNTQAVLERQVRKGLADVPASQMKQVVLAYEPVWAIGTGVTAS
KEQVQETHAALRQLISEIYEKDIAEGLRILYGGSVKATNVDELMSQQDIDGALVGGAALD
SISFARIINFE
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaagagaaaggctttgattgcagggaactggaagatgcatatgacggtgcttgaaggt
tgtcgtctggcagcggaaattgttgcatcctgtaaggattatacggatagagaggtgctt
cttgcaccgccctgcacaataataagcgaagtctcccatatccttgcgggtagtaagatt
atcctctcgtcgcacaatgtctgctgggaagaaaagggtgcctttaccggagagatttct
cccactatgctccaagatgcgggggcaagctgtgcaattgttggccactctgaacgtcgc
caggtattttttgaaagtgatgaggtgattaacaaacgcttaaagggtgctctggccttt
ggtttgatgggcattttatgtattggcgagacccttgaggagcgtgaggcgggcaatacc
caggccgtgcttgagagacaggtgcgtaagggacttgcagatgttcctgcttcccagatg
aaacaggttgttcttgcctatgaacctgtctgggcaattggcaccggagtcacggcaagc
aaggagcaggttcaggaaacacacgctgccctgcggcaattaatttcagaaatatatgaa
aaagatattgcggaaggactgcgtatattgtatggtggctcggttaaagcaaccaatgta
gacgagttgatgtcccaacaggatatcgatggagccttagtaggtggcgcggctttagat
agtatatcttttgctcgcataattaattttgaataa

DBGET integrated database retrieval system