KEGG   Desulfotalea psychrophila: DP0532Help
Entry
DP0532            CDS       T00192                                 

Definition
(GenBank) probable glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
dps  Desulfotalea psychrophila
Pathway
dps00480  Glutathione metabolism
dps00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:dps00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    DP0532
  Metabolism of other amino acids
   00480 Glutathione metabolism
    DP0532
Enzymes [BR:dps01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     DP0532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: CAG35261
UniProt: Q6AQW3
Position
581392..581940
Genome map
AA seq 182 aa AA seqDB search
MNTLKNQTLPLRIIMKRDFYQFSATNLQGQKIAMKEYRGKVMLVVNTASKCALSSQLRGL
EILYKKYAPLGFVVLGFPCNQFTPQESRDAQNIAEEYLLNYGASFPLFTKTEVVGKGAHP
LFSYLENRLEGIMGPDIKWNFTKFLIDHRGDPVKRFAPITAPAIIAPDIEILLSAQSTAG
EQ
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaataccctaaaaaatcaaaccctaccgttgagaataattatgaagagagacttctac
caattttcagcaacaaacctgcagggccagaagatagccatgaaggagtatcggggcaag
gtgatgctggtggtaaacaccgccagtaaatgcgccctgagctcgcaactcaggggctta
gagatactttataagaaatacgccccactaggatttgtggttctgggttttccctgcaat
caattcacccctcaggaatccagagacgcgcagaacattgccgaagagtacctcctcaac
tacggtgcctcctttcccctcttcaccaaaacagaggtcgttggcaagggagcccacccc
ctcttctcctatctggaaaatagattagagggcataatgggtcccgacattaaatggaac
ttcacaaaattcctcatcgaccacaggggagatccggtaaagaggtttgcccccatcacc
gccccagctataatcgccccggatatagaaatactcctatctgcgcagagcactgcaggc
gagcaatag

DBGET integrated database retrieval system