KEGG   Desulfotalea psychrophila: DP0728Help
Entry
DP0728            CDS       T00192                                 

Definition
(GenBank) probable oxygen-insensitive NAD(P)H nitroreductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
dps  Desulfotalea psychrophila
Pathway
dps00633  Nitrotoluene degradation
dps01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dps00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    DP0728
Enzymes [BR:dps01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     DP0728
  1.-  
   1.-.-  
    1.-.-.-  
     DP0728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: CAG35457
UniProt: Q6AQB6
Position
804975..805631
Genome map
AA seq 218 aa AA seqDB search
MTEIENLLHDRYTTKVFDPERTISPEKIQQIKNLLRFSASSVNIQPWHFVLAASEAGKAR
IAQSVVGSYGFNEQKIRDASHVVVLCTRVDLGQEYLQELIEQQERDGRFLQLEDKQNTLD
ATALFSGMHFNELKDGQHWLEKQVYLALGNLLLGAKMLGVDTCPMEGFDAFQLNSDLALR
DRGLCASIIVALGYQDVGDYNAKLPKSRWPQERVFTEI
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgacagagatagaaaatttattacatgatcgatatacaacaaaggtttttgatcctgag
cgaaccatctcacctgaaaaaattcagcagataaaaaacctgcttcgctttagtgcctcc
tcggtaaacatccagccctggcattttgtccttgctgcctccgaggcaggcaaggcgcgt
attgcccagtcagtggtgggctcctatggatttaatgaacagaaaatacgagatgcctcc
catgtagtggtgctctgtacccgggtagacctgggacaggagtacctgcaggagttgatc
gaacaacaggagagggatggtcgttttctccagctggaggataagcaaaataccctggat
gcgacggcccttttttctgggatgcatttcaatgagcttaaggatggtcagcactggttg
gaaaagcaggtgtaccttgccctgggcaatctacttcttggcgccaagatgttgggagtt
gatacatgtcccatggagggatttgatgccttccagctaaatagtgaccttgctcttcgt
gatagagggctctgcgcgtctattattgttgcccttggctatcaggatgtgggggattac
aacgcgaagctaccgaaatctcgttggcctcaggagagggtctttacagaaatttag

DBGET integrated database retrieval system