KEGG   Desulfotalea psychrophila: DP0786Help
Entry
DP0786            CDS       T00192                                 

Definition
(GenBank) probable methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
dps  Desulfotalea psychrophila
Pathway
dps00450  Selenocompound metabolism
dps00970  Aminoacyl-tRNA biosynthesis
dps01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dps00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    DP0786
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DP0786
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dps01007]
    DP0786
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dps03016]
    DP0786
Enzymes [BR:dps01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     DP0786
Amino acid related enzymes [BR:dps01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   DP0786
Transfer RNA biogenesis [BR:dps03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    DP0786
 Prokaryotic type
   Other AARSs
    DP0786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: CAG35515
UniProt: Q6AQ58
Position
884023..885960
Genome map
AA seq 645 aa AA seqDB search
MTTYITTPIYYVNAQPHLGHAYTTIVADTYSRFRHLCGEDVRFQTGTDEHGEKIVEAAEK
NGEAPKEYVDRISGMFRQTWPILGIEPDNYIRTTDANHIATVQKVLQQVYDKGDIYFDKY
TGLYCRGCERFLTEKELVDGKCPDHQTAPQEIAEQNYFFKMSKYQQQLLDHINANEDFIT
PHRYRNEMLSFLSEPLEDLCISRPKSRLTWGIELPFDDNFVTYVWFDALINYLTGLGFPE
DDKYNKFWPVAEHVIAKDILKPHAIFWPTMLMAMELPLYKKLHVHGYWNVDNTKMSKSIG
NVVRPKELVDEYGLDTLRYFTLREMSFGLDASFSSDAIVSRKNSDLANDLGNLFSRSTAM
IQKYRGGKLPAPIACEADSELIALSKQVVATYKEEMGAFRFHRALQAVWSLVGYANKYIV
SNEPWALAKDENAWQRLDTVLYNLAECLRFLALLIRPVMPDTASRMATGLGLATDASILN
SLALGGEWGVVPVGTVLGEAITLFPRMETAKSEEKKAGKKDCQGAKKQEAVISEDGLANF
ADFQKFELRVADIVVAERIKKSDRLLKLTVMAPEERIIVAGIAAHYSPEDVVGLKVIIVA
NLKPAKLMGVMSQGMVLAAKVSEDGGERLVLSGVQGDVPAGTRVA
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgacaacttatataacaactccaatttattacgttaatgctcagccccacctcggtcat
gcctataccaccattgtggctgatacctatagccgttttcgccacctctgtggtgaggat
gttcgttttcaaacgggaactgacgaacatggagaaaaaattgttgaagcagcagagaaa
aatggtgaggctcctaaggagtatgttgatagaataagtggtatgtttcgtcagacctgg
ccaattcttggcatcgagcccgataattatattcgcaccaccgatgccaaccatattgca
actgtacagaaagttctgcaacaggtctacgataagggagatatttattttgataaatat
accggactctactgccgtggttgtgagcgctttttgacagaaaaagagctggtggatgga
aagtgccccgatcatcagactgctcctcaggaaattgccgagcagaattatttctttaag
atgtcaaagtatcagcagcagttgcttgatcatatcaatgccaatgaggattttattacc
cctcatcgttatcgtaatgagatgctctcctttttgagtgaaccgctggaagatctttgc
atctcccgccccaagagtcgtctgacctgggggatagagcttccctttgatgataatttt
gttacctatgtatggtttgatgcccttattaactatttgacaggtcttggttttccagag
gatgataagtataataaattttggcctgttgcagagcatgtgattgccaaagacatcctc
aaaccccacgcaattttttggccaaccatgctgatggccatggaactgcctctctataag
aagttgcatgtgcacggttattggaatgtggacaataccaagatgtctaagagtattggt
aatgttgtccgtccaaaagagcttgtcgatgagtacggtcttgatactcttcgctatttt
accctgagagaaatgtcctttggtcttgatgcttcctttagctccgatgccattgtgtcc
cgtaaaaattccgatttggccaacgatttaggcaatctctttagtcgttccacggccatg
attcaaaagtaccgtggtggcaagttacccgccccgatcgcctgtgaggcagatagtgaa
ctgattgccctgagcaagcaggtagttgccacctataaagaagagatgggtgcctttcgt
tttcacagggccctacaggctgtgtggagtttggtgggatatgccaataaatatattgtc
agcaatgagccatgggccttggctaaagatgaaaatgcttggcagagactggatacagta
ctctataatcttgctgagtgtttacgattcctggctctgttgattcgtcctgttatgcca
gatacagcatcaagaatggccacaggtctaggcctggcgacggatgcatcgatccttaac
tctcttgccttgggtggcgagtggggagttgtgcccgtgggcaccgttttaggtgaggct
attaccctcttcccacgcatggaaacagcgaaaagtgaagagaaaaaggcagggaagaag
gattgtcagggtgcaaaaaaacaggaggcagtgatctccgaggatggtcttgccaatttt
gctgattttcaaaagtttgagttgagggtggcagatattgtggttgctgagaggattaag
aagtccgatcgtctcttaaagttgacagtcatggctccggaggagaggatcattgttgcc
gggattgcagcacattatagtccagaggatgttgttggtctcaaggttattattgttgct
aatttgaagccggcaaaattgatgggtgttatgtctcagggtatggtgcttgcggccaag
gtgagtgaagatggtggcgaacgattggtgctctccggggttcagggtgatgtccctgct
ggaactcgggtagcgtaa

DBGET integrated database retrieval system