KEGG   Desulfotalea psychrophila: DP1199Help
Entry
DP1199            CDS       T00192                                 

Definition
(GenBank) probable pyruvate synthase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
dps  Desulfotalea psychrophila
Pathway
dps00010  Glycolysis / Gluconeogenesis
dps00020  Citrate cycle (TCA cycle)
dps00620  Pyruvate metabolism
dps00633  Nitrotoluene degradation
dps00640  Propanoate metabolism
dps00650  Butanoate metabolism
dps00680  Methane metabolism
dps01100  Metabolic pathways
dps01120  Microbial metabolism in diverse environments
dps01130  Biosynthesis of antibiotics
dps01200  Carbon metabolism
Module
dps_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DP1199
   00020 Citrate cycle (TCA cycle)
    DP1199
   00620 Pyruvate metabolism
    DP1199
   00640 Propanoate metabolism
    DP1199
   00650 Butanoate metabolism
    DP1199
  Energy metabolism
   00680 Methane metabolism
    DP1199
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    DP1199
Enzymes [BR:dps01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     DP1199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR Fer4 Fer4_6 Fer4_2 Fer4_10 Fer4_9 Fer4_21 Fer4_7 Fer4_16 Fer4_4 Fer4_8 Fer4_15
Motif
Other DBs
NCBI-ProteinID: CAG35928
UniProt: Q6ANZ6
Position
1337811..1338740
Genome map
AA seq 309 aa AA seqDB search
MFLQREGVVMYRIRFHGRGGQGMKTASRILGTAFFLEGYEVQDAPRYGAERRGAPIFAYV
RADNQPINERGIISQPDLVIVADDSLVGLPAAAVLAGVDEHTLLLISSAESGEMWQDRLN
FAGEIFTMPAEAQFVGAACTGAAACLLGDISPVALEKAIREELADLGDAVIEENIVPALT
AYKRMQPYRGRVQTGIAINANDYSKPGWIDLPFEDARISAPDIHASANSVEVRTGLWRTL
RPVIDYQRCKGCWWICSTFCPDGAIPVRGKIPEIDYDHCKGCMICVAQCPTHAIEAVSER
LAQEQEVLS
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
ttgtttttgcagcgggagggagttgtcatgtaccgtatacgttttcatggtcgtggtggt
caggggatgaaaactgccagccgtattttgggcactgccttttttctggagggctatgag
gttcaggatgccccccgctatggagctgaacgtcgtggtgccccgatctttgcctatgtg
cgggccgataatcagccaataaatgagcgtggaattattagccaaccggatctggttatt
gtcgccgatgatagtctggtaggtctgcctgccgccgctgtcctggcgggggtggatgaa
catacccttctcttgatcagcagtgctgaaagtggagagatgtggcaggaccggctgaat
tttgccggggagatatttaccatgccggcagaagctcagttcgtcggtgctgcctgtacc
ggggccgccgcctgtctgctgggcgatatatcgcctgtggcattggagaaggcaattaga
gaagagctggcagatttgggcgatgcagttatcgaggagaatattgtcccggcccttaca
gcctataagaggatgcagccctataggggacgggttcagacagggatcgcaatcaatgcc
aacgattacagcaaaccggggtggatagatctaccctttgaagatgcccgtatttcggcc
ccggacatacacgcctcggcaaatagtgtagaggtaagaaccggtctgtggcgtaccctg
cggccggtgattgattatcagcgctgtaaggggtgttggtggatctgtagtaccttttgc
ccggatggtgccattcctgtccggggaaagatcccggaaattgattatgaccactgcaag
ggctgtatgatatgtgtggcccaatgtcccactcacgccattgaggctgtttcggaacgg
ctggctcaagagcaggaggtcttatcatga

DBGET integrated database retrieval system