KEGG   Desulfotalea psychrophila: DP1666Help
Entry
DP1666            CDS       T00192                                 

Definition
(GenBank) related to fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
dps  Desulfotalea psychrophila
Pathway
dps00010  Glycolysis / Gluconeogenesis
dps00030  Pentose phosphate pathway
dps00051  Fructose and mannose metabolism
dps00680  Methane metabolism
dps01100  Metabolic pathways
dps01110  Biosynthesis of secondary metabolites
dps01120  Microbial metabolism in diverse environments
dps01130  Biosynthesis of antibiotics
dps01200  Carbon metabolism
Module
dps_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dps00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DP1666
   00030 Pentose phosphate pathway
    DP1666
   00051 Fructose and mannose metabolism
    DP1666
  Energy metabolism
   00680 Methane metabolism
    DP1666
Enzymes [BR:dps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     DP1666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos GST_C_3
Motif
Other DBs
NCBI-ProteinID: CAG36395
UniProt: Q6AMN0
Position
complement(1863391..1865208)
Genome map
AA seq 605 aa AA seqDB search
MAEKICITEIDKLSQKLLRIETELNANIPTTLWISDLHGEGDRFKSILRGRFGMLYQTCK
EGLPATFTPEKIQYLAKIVRKKNYFADSQQQMDRQDVILCFVQILKYKLTNSTNRNREIF
LPEFRETIGRLLAGLPVPDPIFEESIISDRLIFHLSYAIRQVLLDRIQVLGDVFDRGSQP
DKIIRILSSPAYKEMVDYVFGNHDILWMGAAAGTPSLVAETLRITCRYDHFRLLNRLRFD
TSRLAEFAERTYEIKKATGKFKAKTDRGRAMEKALTVIQFKLEEKLINDFPHYGMEKRLW
LERLAEMLKTGATEELNDSDFPTIDLENPSKLSKEESEIINDLIEQFRSNKYLKRLLKFF
FEEGSTYHISNNFLNIHALVPSTKEGEFEEFMGHKGKDLLDYIQKVIRRTGQNYLYNREQ
SADDLALFFYLWCGPKSPFFGKHAMKTFERYFLLDKERHAEHSLYWQKNMQSDAFKEKMQ
EEFGIQRVIFGHTPVNYMQGNKMASEDGVAINVDGGFAAAYYNRGHALVHTPHQLYGIIL
PTPDELIKAAVRLEPAPLDIEFIDEFPQPLKIKNTIAGKLLQQERDLIMGKIQSYNSQNR
DSDIN
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaaaaatttgtatcaccgagatagataaactctcacaaaaactcctaaggatc
gaaacagagctcaatgcaaacatccccacaaccctgtggatcagcgatctccacggcgaa
ggagatcgttttaaatccattctgcgcggtcgttttggcatgctctaccaaacctgcaaa
gaaggtttacctgccacctttacgcctgaaaaaatacagtatcttgccaaaatagttcgt
aaaaaaaattattttgcggacagccaacaacagatggatagacaggatgtcatcctctgc
tttgtccaaatactcaaatataagctgacaaactctacaaaccgtaaccgcgagatattc
ttgccagaattccgagagaccatcggccgcctgctggcaggtctgccggttcctgacccc
atctttgaagagagtattatctccgatcgcctcatctttcatctcagctatgccattcgc
caggtactccttgatcgtattcaagtacttggggacgtctttgaccgtggttcacaaccc
gacaaaatcatccgcatcctctcctcacctgcctataaagagatggtggactatgtcttt
ggcaaccatgatattctctggatgggagcggcagcaggcaccccgtcgctggtggcagaa
actctgcgcatcacctgtcgctacgaccacttcagactactcaaccgcctgcgctttgat
accagtaggctcgctgaatttgccgagcgcacctatgaaatcaaaaaggccacgggaaaa
ttcaaggccaaaaccgatcgtggtcgggccatggaaaaggcgctcaccgtcattcaattc
aaacttgaagagaaactgatcaacgacttcccccactatggtatggaaaaacgtctgtgg
ctggagagactggcagaaatgctcaaaacaggcgcgacagaggaactcaacgacagcgat
ttcccaaccattgaccttgaaaaccccagcaaactgagcaaggaggagagcgaaatcatc
aatgatctgatagaacagtttcgctccaataaatacctcaaacgtctcctcaagttcttc
tttgaagagggcagcacctatcatatcagtaataatttcttaaatatccacgccctggta
ccgtcaaccaaggaaggcgaatttgaagagttcatgggccataagggcaaggacctgctt
gactatattcaaaaggtcataagacgaacagggcaaaactatctctataaccgggaacag
agtgccgatgatctagccctcttcttctacctctggtgcggacctaaatcaccttttttt
ggcaaacatgccatgaagacctttgaacgctatttcctcctcgataaggagcgacatgcg
gagcactccctctactggcaaaaaaatatgcaaagcgatgccttcaaagaaaaaatgcag
gaggaatttggcatccagagagtgatcttcggccatacccctgttaactatatgcaggga
aataaaatggccagtgaagacggggtggccattaatgtcgatggaggttttgccgccgcc
tactataatcgtggccatgccctggttcataccccgcaccagctctatggcattatcctc
cctaccccggacgagttgataaaggctgcggtaaggcttgaaccggcaccacttgacatt
gaatttattgatgaatttccacagcctctcaagataaaaaacaccattgccggcaagctc
ctgcagcaggagcgagacctgataatgggaaaaatccagtcttacaacagtcagaaccgc
gactcagatataaactaa

DBGET integrated database retrieval system