KEGG   Desulfotalea psychrophila: DP1936Help
Entry
DP1936            CDS       T00192                                 

Definition
(GenBank) related to lipid-A-disaccharide synthase (LpxB)
  KO
K00748  lipid-A-disaccharide synthase [EC:2.4.1.182]
Organism
dps  Desulfotalea psychrophila
Pathway
dps00540  Lipopolysaccharide biosynthesis
dps01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dps00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    DP1936
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dps01003]
    DP1936
   01005 Lipopolysaccharide biosynthesis proteins [BR:dps01005]
    DP1936
Enzymes [BR:dps01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.182  lipid-A-disaccharide synthase
     DP1936
Glycosyltransferases [BR:dps01003]
 Polysaccharide
  Bacterial polysaccharide
   DP1936
Lipopolysaccharide biosynthesis proteins [BR:dps01005]
 Lipid A
  DP1936
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LpxB Epimerase_2 DUF354
Motif
Other DBs
NCBI-ProteinID: CAG36665
UniProt: Q6ALW0
Position
complement(2197009..2198169)
Genome map
AA seq 386 aa AA seqDB search
MDKQKRETGSEIMVVTGEASGDIHGANLVRALKEKDSSLSFSGMGGPELASLGVEILYDA
KKISVVGLVEVFSHLPSIFAAKKILQRRLKNKPPALLIIIDLPDFNLMLAKKAKALGIPV
FYYITPQVWAWRSGRIKTIGERTDQLGVILPFEEEFFRQRGQAASYVGHPLLDNVSIKLS
REEFLTKHRIGPAAKYVGLLPGSREKEISALLPDFLRAAKRLQDECSEKISFLLPIAATI
DREQLLENGLAEYQDLLDIHVISEDRYELMACCDAVVAASGTVTLELAILEVPMLVVYRT
SPISYWVGRKLVKIEFFSLVNLIAGREVVTELLQDEVTPERISIEIKELLYGAKGVAVGK
GLREVHGLLGEAGASAKAADLALSMI
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggataagcagaaacgagaaactggttcagaaatcatggtcgtaaccggagaggcatcg
ggagatatccatggggcaaatttagtgcgggcccttaaggaaaaggattcctccctctct
ttttcagggatgggtggccctgaacttgcctcacttggtgttgaaattctttacgatgca
aaaaaaatctccgttgttggcctagtggaggtattctcgcatctgccctctatttttgct
gccaaaaaaatcctgcaaagacggcttaaaaataaaccgcctgccctgcttatcatcatc
gatctaccggattttaatttgatgctggccaagaaggcaaaagccctcggtatcccggtg
ttctactatattaccccgcaggtttgggcctggcgttccggacgaatcaaaaccatcgga
gagcgaacagatcaacttggagttatcctcccctttgaagaagagttctttcgccagcgg
ggacaggctgcaagctatgtcggccatcctcttctggataacgtcagcataaaactctca
agggaagaatttctcaccaagcacaggatcgggcccgcggcaaaatatgttggtcttctt
cccgggagcagggaaaaagaaatttcagccctgttgccagattttcttcgggcggcaaag
cggctacaggacgagtgtagtgaaaaaatttcatttctactgcccattgccgcaaccatt
gacagggaacaactcctggaaaatggccttgccgaatatcaagacctactcgatatccat
gtgatcagcgaagatcgctatgagcttatggcatgttgtgatgctgtggtggcagcctcc
ggcacggtgactctggagcttgccatccttgaagtgcctatgcttgtggtctatcgcacc
tcaccgatctcttattgggtaggacgaaaactggtcaagatagagttcttttccctggta
aatcttattgccggccgagaggtagtaacagagcttctgcaggacgaggttactccagag
cgaataagtattgagattaaagagctattatatggggcaaagggagtggcggtagggaag
ggccttcgtgaggtacatggcctgcttggcgaagcaggcgcatcggcaaaggcggctgac
cttgccctgagcatgatctaa

DBGET integrated database retrieval system