KEGG   Desulfotalea psychrophila: DP2332Help
Entry
DP2332            CDS       T00192                                 

Definition
(GenBank) probable piperideine-6-carboxylate dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
dps  Desulfotalea psychrophila
Pathway
dps00010  Glycolysis / Gluconeogenesis
dps00053  Ascorbate and aldarate metabolism
dps00071  Fatty acid degradation
dps00280  Valine, leucine and isoleucine degradation
dps00310  Lysine degradation
dps00330  Arginine and proline metabolism
dps00340  Histidine metabolism
dps00380  Tryptophan metabolism
dps00410  beta-Alanine metabolism
dps00561  Glycerolipid metabolism
dps00620  Pyruvate metabolism
dps00625  Chloroalkane and chloroalkene degradation
dps01100  Metabolic pathways
dps01110  Biosynthesis of secondary metabolites
dps01120  Microbial metabolism in diverse environments
dps01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DP2332
   00053 Ascorbate and aldarate metabolism
    DP2332
   00620 Pyruvate metabolism
    DP2332
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DP2332
   00561 Glycerolipid metabolism
    DP2332
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DP2332
   00310 Lysine degradation
    DP2332
   00330 Arginine and proline metabolism
    DP2332
   00340 Histidine metabolism
    DP2332
   00380 Tryptophan metabolism
    DP2332
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DP2332
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    DP2332
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DP2332
Enzymes [BR:dps01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     DP2332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CAG37061
UniProt: Q6AKR4
Position
2664549..2666165
Genome map
AA seq 538 aa AA seqDB search
MLIGLSIFMISLCQPYSPGRGVTSYEDNMESIKKLHIKKANSGICTGTEWISPAGSKVIE
SISPVDGRIIAKIQAGGAPEYKRIITQAQKAFPLWRKIPAPERGEIVRQIGEALRKDKEN
LGRMICLEMGKSLQEGYGEVQEMIDVCDFAVGQSRMLYGATMPSERPSHRLYDQYHPLGV
VGIITAFNFPAAVWAWNAMLSTVCGNVLVWKPSSQVGLTAIAIQHIIARVLKKNKLPEGI
FSLICGSGKDIGDLMLADTRLPLISFTGSVRTGRHAAQIIAGRLGKSLLELGGNNSIIIS
PEADLAIAIPAVVFGAVGTAGQRCTTTRRLIIHESIYDKVRDGLTKAYKSLRIGSPLNQD
NHMGPLVNQDAVANYLAAVETIKDQGGEILCGGHALQGEGFESGCYVAPTLVEVKSDIPI
IKEETFAPILYLIRYSGDINQAIEINNSAHEGLSSAIFSNNLREAETFLSPWGSDCGIAN
VNIGTSGAEIGGAFGGEKDTGGGRESGSDAWKAYMRRQTVTINYGHELPLAQGINFTI
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgttaataggtctttcaattttcatgatctccctctgccagccatactctcctggcaga
ggagtcacaagctacgaggacaatatggaaagtataaaaaaactacatataaagaaagcc
aacagcggtatttgcaccggcacagagtggatctcccccgcaggtagcaaggtcatagaa
tccatctcacctgtggacggaaggatcatcgccaaaatccaagcaggaggagcgcctgaa
tataagcgaattattactcaggcccaaaaggcctttcccctctggcggaaaatccctgcc
cctgagcgtggagaaattgtccgacagattggcgaggccctgcgcaaagataaggagaac
cttggcaggatgatttgcctggagatggggaaatctcttcaggagggatatggagaggta
caggaaatgatcgatgtctgtgactttgccgtgggccagtcacgcatgttatacggcgcc
accatgccctcggaaagaccctcccacagactctacgatcagtatcatccccttggtgtt
gtcggcattattactgcctttaattttcctgccgcagtttgggcctggaacgccatgctc
tcgactgtctgtggcaatgtcttggtatggaagccctcttcccaggtaggcctaaccgcc
attgccatccagcatatcatcgcccgggtcctcaagaaaaacaagctgcccgaaggcatt
ttttctcttatctgtggtagtggcaaggacataggcgacctgatgcttgcagatacccgc
ctgccccttatctcctttaccggttctgttcgtaccggtcgacatgccgcccaaatcatt
gccgggcgcctcggtaaatccctcctagagctgggaggaaataacagtatcattatcagc
ccagaggcagatcttgctattgccatccccgccgtggtctttggcgctgtcggtactgct
ggacaacgctgcaccaccacccgtcgcctgattattcatgaatctatctatgacaaggta
agagatggtctgacaaaggcctataaaagtctgcgtattggcagccccctcaaccaagat
aaccatatggggcccctggtaaaccaggatgccgtcgccaattatctcgcagcagtagag
accatcaaagaccaagggggagagatactatgcggtggccatgccctacaaggagagggc
tttgaatctggctgctatgttgcccccaccctggttgaggtgaaaagcgatatccccatt
atcaaggaggagacctttgctcccatcctctatttaattaggtatagcggagatattaac
caggccatagagatcaataacagtgcccatgagggactctcctctgccattttttccaac
aacctgcgggaggctgaaaccttcctctcgccatggggttctgactgtggcattgccaat
gtcaatatcggtacctcgggggctgagattggcggcgcctttggcggagaaaaagacacc
ggaggtgggcgtgaatccggttcagacgcctggaaggcctatatgcgccgacaaacggtg
accataaactatggccacgaactgcccctggcccaggggataaactttaccatctaa

DBGET integrated database retrieval system